PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG192700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 625aa    MW: 69589.6 Da    PI: 6.0755
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG192700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS337.82e-1032456162373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          + lLl+cA+av+++d   a+ lLa+++ +asp+gd+ qRla++f+e+L+arla+++s+ly++l  ++ts    ++ l a++lf  ++ + 
  Pavir.3NG192700.1.p 245 QALLLRCAQAVATDDRGTAHDLLAQIRRHASPTGDAAQRLAHCFAEGLEARLAGTGSRLYHSLMLRRTS---AVHFLRAYQLFMAACCCK 331
                          679*************************************************************99999...9***************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          k+++   N++I +av+  +r+Hi+D+++++G+QWp Ll+ La+R++gpp++RiTg++ p++g   + +++etg+rL++ A+e+gvpf f+
  Pavir.3NG192700.1.p 332 KVAFAFSNKTISDAVKARRRLHIVDYGLGYGFQWPGLLRGLAARDGGPPEVRITGIDLPQPGfrPAYQIQETGRRLSDCAREFGVPFMFR 421
                          *************************************************************9999************************* PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                            +a + e++++e+L++++ E+l+V++  +  +l+des  l    +rdevL  + +++P+v+++   +  ++++ F +rf eal +ysa 
  Pavir.3NG192700.1.p 422 G-IAAKRETVSPEDLDIDRAEVLVVSSLCHFRHLMDESIVLGRpsPRDEVLGNIGRMQPDVFIHGVMNGGYGTTYFPTRFREALFHYSAQ 510
                          *.69999*******************************98766669******************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          fd l+a++pr+s+er+ vEr ++gr++ nv+acega+r+er et+++W++r ++aG++++pl+ ++ak +   +r  + + + v+e++++
  Pavir.3NG192700.1.p 511 FDLLDATVPRDSQERMLVERDIFGRAALNVIACEGADRVERPETYKQWQARNQRAGLRQLPLKPEVAKVVLDKVRDNYHKDFIVDEDQAW 600
                          ******************************************************************************888********* PP

                 GRAS 358 lvlgWkdrpLvsvSaW 373
                          l+  Wk+r L+ +S W
  Pavir.3NG192700.1.p 601 LLHRWKGRVLYGLSTW 616
                          **************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.773218597IPR005202Transcription factor GRAS
PfamPF035146.8E-101245616IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MDAAPPEPEQ EQEFLSFLHP DPDPPSPSVF LDLPPTPPPP TRHDGDFDDM VLPYVARLLM  60
DEDEDSFFYQ YPDHPALLQA QMPFAQILAD AAQTCTSSSG SASASTSPSC SAHTDSDRSP  120
TSDAAADMDM VTSAFLRGME EATKFLPAPT DNAGLLSRRR AAGDDAPDPE ARRATKLMLP  180
DPDDADTRQM FDEMMLHERD ICMKGVQVQR LSISTTDTNK PNKAQAPRRR GRRSSTSTDD  240
AVDLQALLLR CAQAVATDDR GTAHDLLAQI RRHASPTGDA AQRLAHCFAE GLEARLAGTG  300
SRLYHSLMLR RTSAVHFLRA YQLFMAACCC KKVAFAFSNK TISDAVKARR RLHIVDYGLG  360
YGFQWPGLLR GLAARDGGPP EVRITGIDLP QPGFRPAYQI QETGRRLSDC AREFGVPFMF  420
RGIAAKRETV SPEDLDIDRA EVLVVSSLCH FRHLMDESIV LGRPSPRDEV LGNIGRMQPD  480
VFIHGVMNGG YGTTYFPTRF REALFHYSAQ FDLLDATVPR DSQERMLVER DIFGRAALNV  540
IACEGADRVE RPETYKQWQA RNQRAGLRQL PLKPEVAKVV LDKVRDNYHK DFIVDEDQAW  600
LLHRWKGRVL YGLSTWVADD VVCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-432486168374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012703949.10.0PREDICTED: scarecrow-like protein 9
TrEMBLK3ZHR40.0K3ZHR4_SETIT; Uncharacterized protein
STRINGSi026116m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-139GRAS family protein