PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG192600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 454aa    MW: 50053.9 Da    PI: 5.9724
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG192600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS182.92.2e-562134312217
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lLl+cA+av + d + a++lL +++e+asp+gd++qRla++f+++L+arla+++ ++y++l++++ts    +e l+a++lf  ++ + 
  Pavir.3NG192600.1.p 213 HTLLLHCAKAVID-DRQSAHELLRQIKEHASPTGDTTQRLAHCFAQGLEARLAGKGAQVYRSLTANRTS---LVEFLKAYQLFMSTCCFR 298
                          679********97.8999*******************************************99999998...****************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg........skeeleetgerLakfAeelg 173
                          k+++  aN+aI +a+ g +++Hi+D+++  G+QWp Ll+ L +R++gpp++RiTg++ p+++         ++ + e+g+rL++ A++l 
  Pavir.3NG192600.1.p 299 KVAFTFANKAIFDAAVGRSKLHIVDYGLHSGFQWPELLRLLGTRDGGPPEVRITGIDIPQPEvriididiPANHMAEVGHRLSNCARQLC 388
                          ************************************************************9999*****99******************* PP

                 GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldes 217
                          vp++f++ v+ +++++ + +L+v+p+E l+Vn  ++   l+de 
  Pavir.3NG192600.1.p 389 VPLKFDA-VVAEWHTVCIGHLNVEPDEILVVNDLFNFRILMDEG 431
                          *******.7999********************999877666554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.682186453IPR005202Transcription factor GRAS
PfamPF035147.7E-54213431IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MAPRSFAGLP PTPCFDADVS SSYLSRISLL MEEEEDIACL GPDHPVLIHA QQSFAQILSG  60
ASLLPDQGAV FPGVWDPPKD KEYSTDMFTA AFLRGVEEAS KFLPTDTADN LPRSKETSGR  120
RDSHSVGGDE LEADAGRTTK LPAVESEETG ARKVFEEMML RGFDACSKGM EGLTVSMVNQ  180
IQIAPAEEDG EKKTRRRSRA RGKRRAAKVV DLHTLLLHCA KAVIDDRQSA HELLRQIKEH  240
ASPTGDTTQR LAHCFAQGLE ARLAGKGAQV YRSLTANRTS LVEFLKAYQL FMSTCCFRKV  300
AFTFANKAIF DAAVGRSKLH IVDYGLHSGF QWPELLRLLG TRDGGPPEVR ITGIDIPQPE  360
VRIIDIDIPA NHMAEVGHRL SNCARQLCVP LKFDAVVAEW HTVCIGHLNV EPDEILVVND  420
LFNFRILMDE GCCHNRQPEP EGCCPQQHQQ DEA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-232164318218GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450070.11e-179hypothetical protein SORBIDRAFT_05g027786, partial
TrEMBLC5Y1S41e-179C5Y1S4_SORBI; Putative uncharacterized protein Sb05g027786 (Fragment)
STRINGSb05g027786.11e-178(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-66SCARECROW-like 14