PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG066300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 251aa    MW: 28493.8 Da    PI: 9.9061
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG066300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.31e-234288248
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                         r en   r vtfskRr+g+lKKA ELSvLC+a+v viifsstgk+++
  Pavir.3NG066300.1.p 42 RTENPVHRRVTFSKRREGLLKKARELSVLCGADVGVIIFSSTGKVHD 88
                         67999****************************************97 PP

2K-box27.61.2e-101172011398
                K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                           ++  +q ++ L+ ei  Lq+ +R   G + e++ l  L+ Le+ Le    + Rs K++++  +i+ l++ke  l+++n+ L++k 
  Pavir.3NG066300.1.p 117 RSQVTEQWISLLRHEIGLLQHGLRSTGGGE-ENMRLDRLHVLEKGLELWYCQTRSAKMQIMQHEIQVLKNKESTLKSANEILQQKE 201
                          45667788999***********87766655.9****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.1E-333392IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-2733108IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.743393IPR002100Transcription factor, MADS-box
CDDcd002652.55E-3335110No hitNo description
PRINTSPR004042.7E-233555IPR002100Transcription factor, MADS-box
PfamPF003193.3E-224487IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-235570IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-237091IPR002100Transcription factor, MADS-box
PfamPF014864.6E-11118200IPR002487Transcription factor, K-box
PROSITE profilePS512977.78118207IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MCVRQAGACL QLVPYLLQGQ SKVKVICRQR ETMVRGKVQM RRTENPVHRR VTFSKRREGL  60
LKKARELSVL CGADVGVIIF SSTGKVHDLA TNGNMQSLVE RYQSIAARGK MESKNLRSQV  120
TEQWISLLRH EIGLLQHGLR STGGGEENMR LDRLHVLEKG LELWYCQTRS AKMQIMQHEI  180
QVLKNKESTL KSANEILQQK EDILKAANEI LQNKANEQNQ FMSNCSVFSG SSYSTHYDAN  240
ESCLFTIYSF *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.418882e-38leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedling roots. {ECO:0000269|PubMed:14701936}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.3NG066300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025807982.11e-145MADS-box transcription factor 33-like isoform X1
SwissprotQ2QW552e-77MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLA0A2T8KH901e-143A0A2T8KH90_9POAL; Uncharacterized protein
STRINGPavir.Cb01900.1.p1e-110(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.14e-45AGAMOUS-like 12