PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG050400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 892aa    MW: 98789.2 Da    PI: 6.5824
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG050400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK832.8e-26556606252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ek+ sle++++yF +++k+AAk+Lgvc T++KriCRq+GI+RWP+R+i+++
  Pavir.3NG050400.1.p 556 EKTFSLEVIQNYFTGSLKNAAKSLGVCSTTMKRICRQHGISRWPSRQISKV 606
                          8999********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.075545626IPR003035RWP-RK domain
PfamPF020424.3E-23559606IPR003035RWP-RK domain
SuperFamilySSF542772.78E-22788883No hitNo description
PROSITE profilePS5174517.57798880IPR000270PB1 domain
SMARTSM006662.3E-23798880IPR000270PB1 domain
CDDcd064072.39E-31799879No hitNo description
Gene3DG3DSA:3.10.20.2405.5E-24799879No hitNo description
PfamPF005642.8E-16799879IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 892 aa     Download sequence    Send to blast
MEFDFDSPDG GDAWLLDAMA TSLHFSAASP PLWPCGDPQH PSVVPLDTAA PQDDAPGARA  60
GKSEITKKGE PINGKCQVQL SMVDDYSDSS DFLKERLTLA LRYFKESTNQ HLLVQVWVPI  120
GQGDRYMLST SGQPFVLDQR SIGLLQYRAV SMMYMFSVDG DNVKELGLPG RVYKQKVPEW  180
TPNVQYYSST EYARLNHAIS YNVHGTVALP VFDPYTKSCI AVVELIMTSK KVNYASKVGK  240
VSKALEAVNL KSTEVVEHPY VQTQIFSEGH QAALVEMLEV LTVICEELKL LLAQTWVPCK  300
YQNLLVPCGG VKKSNFNIHG SCAQELCMST SDVAFHVIDA HMWGFRDACV EHHLQKGQGV  360
SGKACILHRP CFSKDVTRFS KMEYPLVHYA HMFGLAGCFS VCLQSAYTGN DDYVLEFFLP  420
PDCREDDEQK VLLESLLALL RQHLHSLHPT TDEGSNEELQ FDAITVMDSN ETKDEHAQHL  480
NFEGGIHAHE SNTHGVHESD SQKRIASSEY EMCLSPENST KCNGKLFVGP NGGCTSDSLL  540
PDNNSKHHGR RRGKAEKTFS LEVIQNYFTG SLKNAAKSLG VCSTTMKRIC RQHGISRWPS  600
RQISKVNRSI SKLKKVIESV EGSESAFTLT SITGPLPIPF SQSNPINIKN GRKTEVSDLS  660
ISSVQENRGS SSKIKLLEND RLGMLIPQRS FLPNINRQIE REKALFLRSS SGEPSPNSGT  720
SEDSCLGSPA NRTFVSTLME PQQNMHKPDR FTKEPFQTQD LLLPGLFVNG AGSSKNCKNH  780
IAAAVPLGSL MSVHNSGIVT VKARYKEDLL RFRFLCSASI IDLKDEVAKR IQLDVVVFDM  840
KYLDDDHEWV KLTCDADLEE CMEISRLSGS NILRLLVTDI APILGSSCGS T*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.3NG050400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805501.10.0protein NLP3-like isoform X1
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A3L6REQ80.0A0A3L6REQ8_PANMI; Protein NLP3-like isoform X1
STRINGPavir.Ca00444.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7