PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3NG034600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 637aa    MW: 71190 Da    PI: 7.4413
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3NG034600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.97.4e-27475525252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ek+ sle++++yF +++k+AAk+Lgvc+T++KriCRq+GI+RWP+R+i+++
  Pavir.3NG034600.1.p 475 EKTFSLEVIQNYFTGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRQISKV 525
                          8999********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.961464545IPR003035RWP-RK domain
PfamPF020421.2E-23478525IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MVDDYSDSSD FLKERLTLAL RYFKESTNQH LLVQVWVPIG QGDRYMLSTS GQPFVLDQRS  60
IGLLQYRAVS MMYMFSVDGD NVKELGLPGR VYKQKVPEWT PNVQYYSSTE YARLNHAISY  120
NVHGTVALPV FDPYTKSCIA VVELIMTSKK VNYASKVGKV SKALEAVNLK STEVVEHPYV  180
QTQIFSEGHQ AALVEMLEVL TVICEELKLL LAQTWVPCKY QNLLVPCGGV KKSNFNIHGS  240
CAQELCMSTS DVAFHVIDAH MWGFRDACVE HHLQKGQGVS GKACILHRPC FSKDVTRFSK  300
MEYPLVHYAR MFGLAGCFSV CLQSAYTGND DYVLEFFLPP DCREDDEQKV LLESLLALLR  360
QHLHSLHPTT DEGSNEELQF DAITVMDSNE TKDEHAQHLN FEGGIHAHES NTHGVHESDS  420
QKRIASSEYE MCLSPENSTK CNGKLFVGPN GGCTSDSLLP DNNSKHHGRR RGKAEKTFSL  480
EVIQNYFTGS LKNAAKSLGV CPTTMKRICR QHGISRWPSR QISKVNRSIS KLKKVIESVE  540
GSESAFTLTS ITGPLPIPFS QSNPINIKNG RKTEVSDLSI SSVQENRGSS SKIKLLENDR  600
LGMLIPQRSF LPNISRQIER EKALFLRSSS GEPSTN*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.3NG034600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805501.10.0protein NLP3-like isoform X1
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A2S3H6R60.0A0A2S3H6R6_9POAL; Uncharacterized protein
STRINGPavir.J38126.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein