PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG495500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 411aa    MW: 46612.3 Da    PI: 10.3346
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG495500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS274.63.1e-848539974373
                 GRAS  74 sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesg..skeel 158
                          ++++l+a++l+  +  + k  +l  Nq+I++a  g++r+Hi+D++i +GlQWp++l+ +a+Rp   ++pp++RiTg++ p+ g   ++++
  Pavir.3KG495500.1.p  85 VADVLQAYQLYMSAICFKKAFYLFSNQTIYRASLGKKRIHIVDYGIHYGLQWPCFLRRIACRPdgaGPPPEVRITGIDLPQRGfhPAQRV 174
                          88999**********************************************************8877899***********9999***** PP

                 GRAS 159 eetgerLakfAeelgvpfefnvlvakrledleleeLrvkp.........gEalaVnlvlqlhrlldesvsles.erdevLklvkslsPkv 238
                          eetg+rL+k+A+e+gvpf+++v++a+r+e+++ e+L+++          +E+l+Vn+++ql++l+desvs+es +rd  L  +++++P+ 
  Pavir.3KG495500.1.p 175 EETGRRLSKYAQEFGVPFSYQVIAASRMETIRAEDLNLNLnlnpygdddDEVLIVNCIFQLENLMDESVSMESsPRDVALGNIRRMRPHA 264
                          **********************************997765566699999***********************999*************** PP

                 GRAS 239 vvvveqeadhnsesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpv 327
                          +++   +a  +++ F++rf eal yysalfd+l +++ +r+s++r+ +E+ ++gr++ nv+acega+r+er et+++W+ r ++aG++++
  Pavir.3KG495500.1.p 265 FIHGTVNAF-SAPFFATRFREALFYYSALFDALdATTTGRDSRQRALIEQNIFGRAALNVIACEGADRVERPETYRQWQVRNRRAGLRQL 353
                          *99988765.599********************888999*************************************************** PP

                 GRAS 328 plsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                          pl+ ++++ ++  ++ ++ + + v+ ++++l++gWk+r L+++S W
  Pavir.3KG495500.1.p 354 PLNPEIVQVVREKVKGCYHKDFVVDTDHHWLLQGWKGRILYAISTW 399
                          ******************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.2261380IPR005202Transcription factor GRAS
PfamPF035141.1E-8185399IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MQPRREGGGG PAHAAPPLRP GGRRRRPPRR HRAPQPDQAP RQPARRRHAA PRPLLRRGPA  60
RAARRLAGTA YHHPPPLMPA AIPPVADVLQ AYQLYMSAIC FKKAFYLFSN QTIYRASLGK  120
KRIHIVDYGI HYGLQWPCFL RRIACRPDGA GPPPEVRITG IDLPQRGFHP AQRVEETGRR  180
LSKYAQEFGV PFSYQVIAAS RMETIRAEDL NLNLNLNPYG DDDDEVLIVN CIFQLENLMD  240
ESVSMESSPR DVALGNIRRM RPHAFIHGTV NAFSAPFFAT RFREALFYYS ALFDALDATT  300
TGRDSRQRAL IEQNIFGRAA LNVIACEGAD RVERPETYRQ WQVRNRRAGL RQLPLNPEIV  360
QVVREKVKGC YHKDFVVDTD HHWLLQGWKG RILYAISTWV ANEDDAGSCF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-306339952374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660358.10.0PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 9
SwissprotP0C8841e-106SCL34_ARATH; Scarecrow-like protein 34
TrEMBLA0A0A9UN521e-176A0A0A9UN52_ARUDO; Uncharacterized protein
TrEMBLC5YQA71e-174C5YQA7_SORBI; Putative uncharacterized protein Sb08g018940
STRINGSb08g018940.11e-174(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29065.11e-107GRAS family protein