PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG254600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 622aa    MW: 70426.8 Da    PI: 5.1655
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG254600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS271.82.2e-832426132373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                           +lL+ cA+av++++   a +lL++++++as +gd++qRla++f ++L+arl++++ +l k l +++ s     e l+a++l+  ++ + 
  Pavir.3KG254600.1.p 242 STLLICCAQAVDTNNYLVAGELLNQIKQHASTTGDATQRLAQCFSKGLEARLMGTGRQLWKLLMAERLS---AMEFLKAYNLYMSACYFN 328
                          579**********************************************************99999998...89**************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                          k++++     I   ++g++r+Hi+D++i   +QW+ L + La+R+ ++pp+++iT++  ++++    + +ee   rL+k+A+elg++f f
  Pavir.3KG254600.1.p 329 KVAYIFSSLSIAGVMKGKSRLHIVDYGIHCAFQWVGLVRWLAKREdGPPPEMKITVMCCSQPSyfPVQWIEEQWYRLSKYASELGLTFVF 418
                          *********************************************66777*****9765555455************************* PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                          +v v++++ ++ +++L+++ +E+++V+  ++  +l des   +s  +rd+vL+++k+++P++++ +  +++  ++ Fl rf e l yysa
  Pavir.3KG254600.1.p 419 EV-VTTEWGKVCIDDLNLDADEVVVVSDLFNFSTLKDESIYFDSpnPRDTVLSTIKKMRPNIFIQSILNCSQ-GSCFLSRFREMLFYYSA 506
                          *9.7999********************************98877779******************9999998.779************** PP

                 GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesg 356
                          lfd+l++ +prese+r+++E+ l+g  + n +aceg + ++  e++++W++r ++aG++++pl++ ++k  k  ++k++ + + + ee +
  Pavir.3KG254600.1.p 507 LFDMLDVIVPRESETRSVLEQDLFGSCVLNGIACEGVDLVQCPEKYKQWQSRNQRAGLRQLPLRSVVVKVLKDKVKKHHHKDFLLSEEGQ 596
                          *******************************************************************************888******** PP

                 GRAS 357 slvlgWkdrpLvsvSaW 373
                          +l++gWk+r+L++ S W
  Pavir.3KG254600.1.p 597 WLLQGWKGRALFAHSTW 613
                          ***************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.072215594IPR005202Transcription factor GRAS
PfamPF035147.5E-81242613IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MAATPEEFFA EGLMEPSPPS PSVFLDLTPI SDPNTADKGQ LSHDDLVLPY ISRMLMEDDI  60
DDKLLCQYSD HPALLQAQQP FNQILSSPST GTNKDDAANK DTMDQGNDLL LVSSGDESTL  120
SFGLPNSEYV VGEFLKGMEV ADRLLPRDNS FVKDHQMSQI FIRSKRKHME EELGRTSKIL  180
MMTEVPEETG IREVLDNMMM HGNDTLIRDM EKLRIAMDNK EEKKSRKGCS KVMTTGDMVD  240
LSTLLICCAQ AVDTNNYLVA GELLNQIKQH ASTTGDATQR LAQCFSKGLE ARLMGTGRQL  300
WKLLMAERLS AMEFLKAYNL YMSACYFNKV AYIFSSLSIA GVMKGKSRLH IVDYGIHCAF  360
QWVGLVRWLA KREDGPPPEM KITVMCCSQP SYFPVQWIEE QWYRLSKYAS ELGLTFVFEV  420
VTTEWGKVCI DDLNLDADEV VVVSDLFNFS TLKDESIYFD SPNPRDTVLS TIKKMRPNIF  480
IQSILNCSQG SCFLSRFREM LFYYSALFDM LDVIVPRESE TRSVLEQDLF GSCVLNGIAC  540
EGVDLVQCPE KYKQWQSRNQ RAGLRQLPLR SVVVKVLKDK VKKHHHKDFL LSEEGQWLLQ  600
GWKGRALFAH STWVVEDGSS K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-282456138374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978028.20.0PREDICTED: scarecrow-like protein 9
TrEMBLK3YDL30.0K3YDL3_SETIT; Uncharacterized protein
STRINGSi012318m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-102GRAS family protein