PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG173200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 486aa    MW: 55800.8 Da    PI: 8.9879
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG173200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS293.65.2e-901104793373
                 GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          + L++cA+av+++d+ +a +lL++++++as++gd++qRla++f+++L+arl++++s++ +   +++ s    +e l+a++l   ++ + k
  Pavir.3KG173200.1.p 110 TILIHCAQAVAANDHMRAGELLKQIKKHASETGDATQRLAQCFAKGLEARLVGMGSKVWQLRMAERLS---IVEILKAHNLCMAACSFNK 196
                          679**************************************************999998765555555...9****************** PP

                 GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                          +  l    +Il+a+ g++r+Hi+D+++  G++W+ Ll+ +a R++gpp+++iT++g p+      e++eetg+rL+k A+e+gvpf+f++
  Pavir.3KG173200.1.p 197 VMLLFSTMTILQAMVGKRRLHIVDYGMHCGFHWAELLRLMARREGGPPKVKITAIGYPHLRpcPIEQIEETGRRLSKCAHEFGVPFNFHA 286
                          *********************************************************9988999************************** PP

                 GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                           + k++e++++e+L+ + +++l+Vn +++  +l+des   ++  ++d+vL+ +++++P+v++ +  ++++ ++s+l rf eal+yy+a+f
  Pavir.3KG173200.1.p 287 -IRKKWEEVRIENLDKDVEDVLIVNDHFSFNTLMDESIFFDDpsPKDTVLQNIRKMRPDVFIQSILNSSY-GSSYLSRFREALSYYTAMF 374
                          .7***********************************97776669************************9.6789*************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d ++a +pres+ r+++E+ ++gr + n++acega+  er e++++W++r ++aG++++pl+  +++  k    +++ + +   e+ ++l
  Pavir.3KG173200.1.p 375 DIFDAIIPRESKSRVVLEQDIFGRFALNIIACEGADLMERPEKYKQWQARNQRAGLRQLPLKPAIVNVLKDKAMRCHHKDFLFCEDGQWL 464
                          *****************************************************************************888********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          ++gW++r L + SaW
  Pavir.3KG173200.1.p 465 LQGWMGRILCAQSAW 479
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.55482460IPR005202Transcription factor GRAS
PfamPF035141.8E-87110479IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MLLPRGNGFG RGELVNQMVR ESNSHIRAKK RYASDDHLEE VRRTSKPMMM IKEPKDICAY  60
EMWDDIMSNS YETYIVRGME QLRSAMANKV EKNSRKDSRK VVANVVDIHT ILIHCAQAVA  120
ANDHMRAGEL LKQIKKHASE TGDATQRLAQ CFAKGLEARL VGMGSKVWQL RMAERLSIVE  180
ILKAHNLCMA ACSFNKVMLL FSTMTILQAM VGKRRLHIVD YGMHCGFHWA ELLRLMARRE  240
GGPPKVKITA IGYPHLRPCP IEQIEETGRR LSKCAHEFGV PFNFHAIRKK WEEVRIENLD  300
KDVEDVLIVN DHFSFNTLMD ESIFFDDPSP KDTVLQNIRK MRPDVFIQSI LNSSYGSSYL  360
SRFREALSYY TAMFDIFDAI IPRESKSRVV LEQDIFGRFA LNIIACEGAD LMERPEKYKQ  420
WQARNQRAGL RQLPLKPAIV NVLKDKAMRC HHKDFLFCED GQWLLQGWMG RILCAQSAWV  480
AEDAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-341124798374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978278.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3YDM30.0K3YDM3_SETIT; Uncharacterized protein
STRINGSi012328m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-117GRAS family protein