PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG170300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 603aa    MW: 68427.1 Da    PI: 6.5453
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG170300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS298.41.8e-912285962373
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++ L++cA+av+++d+++a +lL++++++as++gd +qRla++f+++L+arl++++s++ + l++++ s    +e l+a++l   ++ + 
  Pavir.3KG170300.1.p 228 RTILIHCAQAVAANDHKRAGELLKQIKQHASETGDVTQRLAQCFARGLEARLVGMGSQVWQLLRAEHIS---IVEFLKAHNLCMTACSFN 314
                          678**********************************************************99999998...9***************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl 181
                          ++  l    +Il+a+ g++r+Hi+D+++ +G++W+ Ll+ La R++gpp+++iT++g +++g  e++eetg+rL+k A+elgvpf+f++ 
  Pavir.3KG170300.1.p 315 RVMLLFSTMTILQAMVGKRRLHIVDYGMHYGFHWAELLRLLARREGGPPKVKITAIGYSRKGGPEKIEETGRRLSKCAHELGVPFHFHA- 403
                          **********************************************************9999***************************. PP

                 GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + k++e++ +e+L+ + +++l+Vn  ++  +l+des   ++  ++d+vL+ +++++P+v++ +  ++++ ++s+l rf eal+yy+a+fd
  Pavir.3KG170300.1.p 404 IRKEWEEVCIEDLDKDAEDVLIVNDRFSFNTLMDESIFFDDpsPKDTVLQNIRNMRPDVFIQSILNTSY-GSSYLSRFREALSYYTAMFD 492
                          7***********************************97776669**********************999.6789**************** PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                           ++a +pres++r+++E+ ++gr + n++acega+  er e++++W++r ++aG++++pl+  +++  k    +++ + + + e+ ++l+
  Pavir.3KG170300.1.p 493 IFDAIIPRESKTRVVLEQDVFGRFALNIIACEGADLMERPEKYKQWQARNQRAGLRQLPLEPAIVDVLKDKATRCHHKDFLICEDGQWLL 582
                          ****************************************************************************888*********** PP

                 GRAS 360 lgWkdrpLvsvSaW 373
                           gW++r L + SaW
  Pavir.3KG170300.1.p 583 HGWMGRILCAQSAW 596
                          ************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.377201577IPR005202Transcription factor GRAS
PfamPF035146.2E-89228596IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MEQSAQTLSV FLNSFSSKPD GRIEGNHYVP SDMILPYISQ LLMEDDIDDT LSDHPALLHV  60
QQPFAQILSS CFGSDNGDTG EASKDLLQDG GGDERTLNLA LSKGTHAVWA FLEGMKEAHM  120
FLPRANGFGR GELVNQMVGE SSNHNRAKKR YASDDHLEEV RRTSKSMMMI KEPKDICAHE  180
MWDDIMSHGY DTYIIRGMEQ LRIAMANEAE KNSRKDSRKT VVNVVDIRTI LIHCAQAVAA  240
NDHKRAGELL KQIKQHASET GDVTQRLAQC FARGLEARLV GMGSQVWQLL RAEHISIVEF  300
LKAHNLCMTA CSFNRVMLLF STMTILQAMV GKRRLHIVDY GMHYGFHWAE LLRLLARREG  360
GPPKVKITAI GYSRKGGPEK IEETGRRLSK CAHELGVPFH FHAIRKEWEE VCIEDLDKDA  420
EDVLIVNDRF SFNTLMDESI FFDDPSPKDT VLQNIRNMRP DVFIQSILNT SYGSSYLSRF  480
REALSYYTAM FDIFDAIIPR ESKTRVVLEQ DVFGRFALNI IACEGADLME RPEKYKQWQA  540
RNQRAGLRQL PLEPAIVDVL KDKATRCHHK DFLICEDGQW LLHGWMGRIL CAQSAWVAED  600
TS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-282315968374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978277.10.0PREDICTED: scarecrow-like protein 33
RefseqXP_004978278.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3ZDK10.0K3ZDK1_SETIT; Uncharacterized protein
STRINGSi024639m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-114GRAS family protein