PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG076500.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 775aa    MW: 85699.7 Da    PI: 7.0466
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG076500.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.83.7e-27431481252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ek+ sle++++yF +++k+AAk+Lgvc+T++KriCRq+GI+RWP+R+i+++
  Pavir.3KG076500.3.p 431 EKTFSLEVIQHYFTGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRQISKV 481
                          8999********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.961420501IPR003035RWP-RK domain
PfamPF020421.8E-23434481IPR003035RWP-RK domain
SuperFamilySSF542773.92E-23670765No hitNo description
SMARTSM006664.1E-25680762IPR000270PB1 domain
PROSITE profilePS5174518.27680762IPR000270PB1 domain
CDDcd064078.25E-33681761No hitNo description
PfamPF005643.7E-17681761IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.3E-25681761No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 775 aa     Download sequence    Send to blast
MLSTSGQPFV LDQQSIGLLQ YRAVSMMYMF SVDGDNVKEL GLPGRVYKQK VPEWTPSVQY  60
YSSTEYARLN HAISYNVHGT VALPVFDPST KSCIAVVELI MTSKKVNYAS EVGKVSKALE  120
AVDLKSTEVV EHPYVQTQIF NEGHQAALVE MLEVLTVICE ELKLPLAQTW VPCKYQNLLV  180
PCGGVKKSSF NIHGSCAQEL CMLTSDVAFH VIDAHMWGFR DACVEHHLQK GQGVSGKACI  240
LRRPCFSKDV TRFSKLEYPL VHYARMFGLA GCFSVCMQSA YTGNDDYVLE FFLPPDCRED  300
AEKMVLLESI LALLRQHLRS LHVATDEVSH EELQVDAITV IDNNETKDEH AQHLNFQVGI  360
HASHESNMHG VHESDSQKRI ASPEYEMCLS PENSTKCNGK LFVGPNGGCT SDSLLPNNNS  420
KHHGRRRGKA EKTFSLEVIQ HYFTGSLKNA AKSLGVCPTT MKRICRQHGI SRWPSRQISK  480
VNRSISKLKK VIESVEGSES AFTLTSITGP LPVPFTPSNP TNIKNGRQTE VTDLSIPSVQ  540
ENRGSSSQIK LLENDDRLGM LIPQRSFLAN ISKQIEREKA LNLRSSSGEP STNSGTSEDS  600
CLGSPANRTF VSLLMEPQQN MRKPERFTKE PFQTQDLLLP GLFVNGSGSS KNCKNHITAA  660
VNEPAVVPPG SLMSVHNSGI VTVKARYKED LLRFRFPCSA SIIDLKDEVA KRIQIDVGVF  720
NIKYLDDDHE WVKLTCDADL EECIEISRLS GSNVLRLLVS DIAPILGSSC GSTG*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.3KG076500.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805502.10.0protein NLP3-like isoform X2
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A2S3H6R60.0A0A2S3H6R6_9POAL; Uncharacterized protein
STRINGPavir.Ca00444.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein