PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG076500.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 837aa    MW: 93016.2 Da    PI: 7.3326
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG076500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.74.1e-27493543252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ek+ sle++++yF +++k+AAk+Lgvc+T++KriCRq+GI+RWP+R+i+++
  Pavir.3KG076500.2.p 493 EKTFSLEVIQHYFTGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRQISKV 543
                          8999********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.961482563IPR003035RWP-RK domain
PfamPF020421.9E-23496543IPR003035RWP-RK domain
SuperFamilySSF542774.58E-23732827No hitNo description
SMARTSM006664.1E-25742824IPR000270PB1 domain
PROSITE profilePS5174518.27742824IPR000270PB1 domain
CDDcd064071.47E-32743823No hitNo description
Gene3DG3DSA:3.10.20.2401.5E-25743823No hitNo description
PfamPF005644.1E-17743823IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 837 aa     Download sequence    Send to blast
MTKKGEPING KCQVHLSMVD DYSDSSYFLK ERLTLALRYF KESTNQHLLV QVWVPIRKGD  60
RYMLSTSGQP FVLDQQSIGL LQYRAVSMMY MFSVDGDNVK ELGLPGRVYK QKVPEWTPSV  120
QYYSSTEYAR LNHAISYNVH GTVALPVFDP STKSCIAVVE LIMTSKKVNY ASEVGKVSKA  180
LEAVDLKSTE VVEHPYVQTQ IFNEGHQAAL VEMLEVLTVI CEELKLPLAQ TWVPCKYQNL  240
LVPCGGVKKS SFNIHGSCAQ ELCMLTSDVA FHVIDAHMWG FRDACVEHHL QKGQGVSGKA  300
CILRRPCFSK DVTRFSKLEY PLVHYARMFG LAGCFSVCMQ SAYTGNDDYV LEFFLPPDCR  360
EDAEKMVLLE SILALLRQHL RSLHVATDEV SHEELQVDAI TVIDNNETKD EHAQHLNFQV  420
GIHASHESNM HGVHESDSQK RIASPEYEMC LSPENSTKCN GKLFVGPNGG CTSDSLLPNN  480
NSKHHGRRRG KAEKTFSLEV IQHYFTGSLK NAAKSLGVCP TTMKRICRQH GISRWPSRQI  540
SKVNRSISKL KKVIESVEGS ESAFTLTSIT GPLPVPFTPS NPTNIKNGRQ TEVTDLSIPS  600
VQENRGSSSQ IKLLENDDRL GMLIPQRSFL ANISKQIERE KALNLRSSSG EPSTNSGTSE  660
DSCLGSPANR TFVSLLMEPQ QNMRKPERFT KEPFQTQDLL LPGLFVNGSG SSKNCKNHIT  720
AAVNEPAVVP PGSLMSVHNS GIVTVKARYK EDLLRFRFPC SASIIDLKDE VAKRIQIDVG  780
VFNIKYLDDD HEWVKLTCDA DLEECIEISR LSGSNVLRLL VSDIAPILGS SCGSTG*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.3KG076500.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805501.10.0protein NLP3-like isoform X1
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A2S3H6V20.0A0A2S3H6V2_9POAL; Uncharacterized protein
STRINGPavir.Ca00444.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7