PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG076500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 906aa    MW: 100174 Da    PI: 6.7436
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG076500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.64.5e-27562612252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ek+ sle++++yF +++k+AAk+Lgvc+T++KriCRq+GI+RWP+R+i+++
  Pavir.3KG076500.1.p 562 EKTFSLEVIQHYFTGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRQISKV 612
                          8999********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.961551632IPR003035RWP-RK domain
PfamPF020422.1E-23565612IPR003035RWP-RK domain
SuperFamilySSF542774.91E-23801896No hitNo description
PROSITE profilePS5174518.27811893IPR000270PB1 domain
SMARTSM006664.1E-25811893IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.7E-25812892No hitNo description
CDDcd064071.70E-32812892No hitNo description
PfamPF005644.6E-17812892IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 906 aa     Download sequence    Send to blast
MEFDFDSPDG GDAWLLDAMA TSLHFSAASP PLPLPPPWPC GDPHHPSVVP LDTAAPQDDA  60
PGARAGKSEM TKKGEPINGK CQVHLSMVDD YSDSSYFLKE RLTLALRYFK ESTNQHLLVQ  120
VWVPIRKGDR YMLSTSGQPF VLDQQSIGLL QYRAVSMMYM FSVDGDNVKE LGLPGRVYKQ  180
KVPEWTPSVQ YYSSTEYARL NHAISYNVHG TVALPVFDPS TKSCIAVVEL IMTSKKVNYA  240
SEVGKVSKAL EAVDLKSTEV VEHPYVQTQI FNEGHQAALV EMLEVLTVIC EELKLPLAQT  300
WVPCKYQNLL VPCGGVKKSS FNIHGSCAQE LCMLTSDVAF HVIDAHMWGF RDACVEHHLQ  360
KGQGVSGKAC ILRRPCFSKD VTRFSKLEYP LVHYARMFGL AGCFSVCMQS AYTGNDDYVL  420
EFFLPPDCRE DAEKMVLLES ILALLRQHLR SLHVATDEVS HEELQVDAIT VIDNNETKDE  480
HAQHLNFQVG IHASHESNMH GVHESDSQKR IASPEYEMCL SPENSTKCNG KLFVGPNGGC  540
TSDSLLPNNN SKHHGRRRGK AEKTFSLEVI QHYFTGSLKN AAKSLGVCPT TMKRICRQHG  600
ISRWPSRQIS KVNRSISKLK KVIESVEGSE SAFTLTSITG PLPVPFTPSN PTNIKNGRQT  660
EVTDLSIPSV QENRGSSSQI KLLENDDRLG MLIPQRSFLA NISKQIEREK ALNLRSSSGE  720
PSTNSGTSED SCLGSPANRT FVSLLMEPQQ NMRKPERFTK EPFQTQDLLL PGLFVNGSGS  780
SKNCKNHITA AVNEPAVVPP GSLMSVHNSG IVTVKARYKE DLLRFRFPCS ASIIDLKDEV  840
AKRIQIDVGV FNIKYLDDDH EWVKLTCDAD LEECIEISRL SGSNVLRLLV SDIAPILGSS  900
CGSTG*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.3KG076500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805501.10.0protein NLP3-like isoform X1
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A2S3H6V20.0A0A2S3H6V2_9POAL; Uncharacterized protein
STRINGPavir.Ca00444.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein