PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG068700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 384aa    MW: 41401.7 Da    PI: 5.3545
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG068700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK70.32.6e-22295344352
               RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ++++l+dl++yF+lp+++AA+ Lgvc+TvLK + R++ ++RWPhRkiks+
  Pavir.3KG068700.1.p 295 SKLQLSDLARYFHLPMTQAARLLGVCATVLKTTSRRFHVPRWPHRKIKSI 344
                          689*********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.358284364IPR003035RWP-RK domain
PfamPF020425.5E-20297344IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MADGHGEATD WEEGPYDPLL VQDDLDDVMH LLDMPAVVLD PAPLAVAQQD NLQEWPPANY  60
LNNDSVDSRA PTHDAAVAGD RPSTSSTQYA GAGTSATAGA HDENALLDCS GCHVLREVLH  120
SNGLEATKLC VHGNSGVFYH ATLEVYRINS EGMATALTHQ SYIDFRGLDY MWVKHYLTGY  180
AQQRAGGGYT VVHDSISAFH DALSVSMNYD GDGGNADGDD HRREGMEVAA AVGNGGCGGD  240
QDDGAVDAEQ PLIEPGDVPA TAGPSEPSAS NDHQERREVR KVGRSAIAIQ RQRASKLQLS  300
DLARYFHLPM TQAARLLGVC ATVLKTTSRR FHVPRWPHRK IKSIDNHIAK LRRSGDNGGA  360
ATKGEMERLI ESRRKIYADL LGQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.3KG068700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021321666.11e-106uncharacterized protein LOC8084238
TrEMBLA0A2T7E6840.0A0A2T7E684_9POAL; Uncharacterized protein
STRINGPavir.Ca00391.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80552944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.13e-13RWP-RK domain-containing protein