PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG503700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 196aa    MW: 20571.8 Da    PI: 10.8683
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG503700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP119.91.2e-3796172278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          Cqve+C+adl  a++y+rrhkvCe hsk  +vlv+gl+qrfCqqCsrfhel efD +k+sCrrrL +hn+rrrk++a
  Pavir.2NG503700.1.p  96 CQVERCAADLHVARRYYRRHKVCEPHSKELAVLVAGLRQRFCQQCSRFHELLEFDGDKHSCRRRLMGHNARRRKSSA 172
                          **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.6E-3191157IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.25693170IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.54E-3594174IPR004333Transcription factor, SBP-box
PfamPF031104.5E-3096169IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MRAKQASKRG SRAPHPPRQL SSPDGAAMDR KGPSSSAAAS MAALAAAAAA GQANGALSPH  60
AEEDENPATL AAVGGASGSS DPVAARRGAA GGGPSCQVER CAADLHVARR YYRRHKVCEP  120
HSKELAVLVA GLRQRFCQQC SRFHELLEFD GDKHSCRRRL MGHNARRRKS SADRHGGGGD  180
QDGRSHPGNP SRNHF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-3075169184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.79540.0callus| leaf| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.2NG503700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025799709.12e-83squamosa promoter-binding-like protein 13
TrEMBLA0A2T7EWG95e-82A0A2T7EWG9_9POAL; Uncharacterized protein
STRINGPavir.Ba01146.1.p1e-136(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85243248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.11e-33squamosa promoter binding protein-like 5