PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG503500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 213aa    MW: 21749.8 Da    PI: 9.2735
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG503500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.51.1e-3991168178
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          +Cq+e+C+adl+ea +y rrhkvC++hskapvvlv+gl+qrfCqqCsrfhelsefD++krsCr rLa+hnerrrk++a
  Pavir.2NG503500.1.p  91 RCQAERCNADLNEAAQYCRRHKVCQTHSKAPVVLVAGLRQRFCQQCSRFHELSEFDDNKRSCRLRLAGHNERRRKSAA 168
                          6**************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.8E-3386153IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.48789166IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-3690171IPR004333Transcription factor, SBP-box
PfamPF031102.3E-3092165IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MDRREKFRRG SSSSAAAAAS MAALAAAAAA GEGSSSGSGS GSADGALPPH GEEEEDQKPP  60
KLAAVGGVSS SSPSPVPARR GAAAGGGGGP RCQAERCNAD LNEAAQYCRR HKVCQTHSKA  120
PVVLVAGLRQ RFCQQCSRFH ELSEFDDNKR SCRLRLAGHN ERRRKSAADT HGHGGGGAGA  180
GAGAGDGCRH ADQDGRGHQG NPPPPNHFQQ IR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3383165284squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.174730.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.2NG503500.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0654453e-91BT065445.2 Zea mays full-length cDNA clone ZM_BFb0161D05 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957796.18e-69squamosa promoter-binding-like protein 13
SwissprotQ6Z4611e-48SPL13_ORYSJ; Squamosa promoter-binding-like protein 13
TrEMBLA0A3L6T7T32e-72A0A3L6T7T3_PANMI; Squamosa promoter-binding-like protein 13
STRINGPavir.Ba00884.1.p2e-89(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85243248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.12e-34squamosa promoter binding protein-like 3