PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG461100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 350aa    MW: 38129.8 Da    PI: 9.5788
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG461100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK932.1e-293283152
               RWP-RK  1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                         aek++sl++l++yF++++kdAA++Lgvc+T+LKriCRq+GI RWP+Rkik++
  Pavir.2NG461100.1.p 32 AEKTVSLQVLRQYFAGSLKDAARSLGVCPTTLKRICRQHGITRWPSRKIKKV 83
                         5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.73422103IPR003035RWP-RK domain
PfamPF020427.3E-263583IPR003035RWP-RK domain
SuperFamilySSF542771.67E-22240338No hitNo description
Gene3DG3DSA:3.10.20.2402.4E-25247332No hitNo description
SMARTSM006661.7E-19251334IPR000270PB1 domain
PROSITE profilePS5174522.081251334IPR000270PB1 domain
CDDcd064071.36E-42252332No hitNo description
PfamPF005648.9E-17252332IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MHGMFSSGGQ GPSLSGVQAT AEGSKAKRRT KAEKTVSLQV LRQYFAGSLK DAARSLGVCP  60
TTLKRICRQH GITRWPSRKI KKVDHSLRKL QQIIDSVHGA ETSFQLNTLY KDLTNTSISS  120
ENNLSGSNTA PPTNQSNLTN FDKHQHHKSN SIVPSTSHSH SSCSHNSDSS PSCSGGPTKH  180
APQGIIGLMK SGNPVKDSPI QNLQTENTSL YEHFSVNEAP TDLLQDVTEK ANGGLHSKRS  240
PSSPKQNAEA NMRVKATFGS EKVRFRLNHE CNFQELKHEI AKRLSIVDTS SLILKYLDDD  300
SEWVLMTCDA DLQECLHVYK LADIQTIKIS VHLAVSPATR VTTGHAGLS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.190333e-34leaf| root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.2NG461100.1.p
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9712710.0EU971271.1 Zea mays clone 360961 NIN-like protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025800526.10.0protein NLP1-like isoform X1
RefseqXP_025800527.10.0protein NLP1-like isoform X2
TrEMBLA0A3L6TG430.0A0A3L6TG43_PANMI; Protein NLP1 isoform X2
STRINGPavir.Bb02544.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55543852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.11e-56Nin-like family protein