PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG441900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family TCP
Protein Properties Length: 330aa    MW: 33625.5 Da    PI: 4.6649
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG441900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP101.81.2e-3173161795
                  TCP   7 rhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaa 95 
                          r  ++hTkv+gR+RR+R+ a+caar+  L++eL +++d++ti WLlqq++pai+++tgt++ +a +++ ++ +    ++ +++aa++ +
  Pavir.2NG441900.1.p  73 RYRDRHTKVEGRGRRIRMAAPCAARVARLTRELQHKSDGETIRWLLQQSEPAIIAATGTGTVPAIAVTGSDGVLRLPAEPAPAAAADVE 161
                          678********************************************************888886665555555544333332222211 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136923.28574128IPR017887Transcription factor TCP subgroup
PfamPF036341.9E-2475137IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MEPRAPGRGE EDAEPLYLAA EAGGNGTAAA FPVAVDAMGS VEAGGSGVPK PEPVPVEFLG  60
GGLQLANPRP APRYRDRHTK VEGRGRRIRM AAPCAARVAR LTRELQHKSD GETIRWLLQQ  120
SEPAIIAATG TGTVPAIAVT GSDGVLRLPA EPAPAAAADV EQQEPAPKRR RKLQPTRAAA  180
GPSAPAPAAY YPVVADPLLQ ANGGGAISMS SGLAPASAPA APAGAIPFLA LPAAGPGATG  240
DGKQMIPPAA VWMVPQQAGA AGAANQPTHY WAFPTNPELF NVANFQQQAV YGAEQLAGNG  300
ESRDQQPGGQ QSEGEDEEEI AVTDSSSEE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1166172PKRRRKL
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings and leaves, mostly in the lower region rich in dividing cells. {ECO:0000269|PubMed:9338963}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.2NG441900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803340.10.0transcription factor PCF2-like
SwissprotA2YXQ11e-83PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH61e-83PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A3L6QPY70.0A0A3L6QPY7_PANMI; Transcription factor PCF2-like
STRINGPavir.Ba01284.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.22e-33TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]