PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG419300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 442aa    MW: 46223.6 Da    PI: 7.5181
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG419300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.21.5e-40111187278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          C v+gC+adls++++yhrrhkvCe+hsk+pvv+v+g+e rfCqqCsrfh l efD++krsCr+rL++hn+rrrk+q+
  Pavir.2NG419300.1.p 111 CAVDGCKADLSKCRDYHRRHKVCEAHSKTPVVVVAGREMRFCQQCSRFHLLVEFDDAKRSCRKRLDGHNRRRRKPQT 187
                          **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-35103172IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.983108185IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-38109190IPR004333Transcription factor, SBP-box
PfamPF031101.0E-30111184IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MDWDLKMPVS WDLADLEHDA VPAIATAAAA PRAAASSGIA AAAAASARGA PSRAECSVDL  60
KLGGLGEFGA ADRMKEPVSA GAAAAAVPSA SPMKRPRSGA SGGGGAQCPS CAVDGCKADL  120
SKCRDYHRRH KVCEAHSKTP VVVVAGREMR FCQQCSRFHL LVEFDDAKRS CRKRLDGHNR  180
RRRKPQTDTM NSGTFMTSQQ GLFSSAGTRF SSFPAPRPEP SWSGVIKSED SSYYTHHQVL  240
STRPHFAGST PAYSNSKEGR RFPFLQDGDQ VSFSAGAAAA LEVSAVCQPL LKTVAPPPES  300
SSSNKIFSDG LTPVLDSDCA LSLLSSPANS SSVDVSRMVQ PTEHIPMAQP LVPSLHPQQQ  360
QQHQFGSPPG WFACSQAGSS GVASAAGAGG FACPPSVESE QLNTVLVPGS DGHEMNYHGI  420
FHVGGEGSSD GTSPSLPFSW Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2799184184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1167184KRSCRKRLDGHNRRRRKP
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.2NG419300.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0538750.0BT053875.1 Zea mays full-length cDNA clone ZM_BFb0379K14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025803088.10.0squamosa promoter-binding-like protein 18 isoform X1
SwissprotQ0J0K11e-164SPL18_ORYSJ; Squamosa promoter-binding-like protein 18
TrEMBLA0A2S3H1560.0A0A2S3H156_9POAL; Uncharacterized protein
STRINGPavir.Ba01534.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.13e-41SBP family protein