PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG323700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family G2-like
Protein Properties Length: 502aa    MW: 51441.1 Da    PI: 7.1449
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG323700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.1e-32257310255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Pavir.2NG323700.1.p 257 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 310
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15254311IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28255311IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23257310IPR006447Myb domain, plants
PfamPF002499.6E-7258309IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 502 aa     Download sequence    Send to blast
MEASSAASPD LSLHISLPSS APRSGPSGGR ATVGGAGGGG GAGGDPWRRL NGSTASTELS  60
LSPPAEQEHA DALPWRHSPS SAAGAPSAAT TSAGAALMPT MPMLQPLEGG GGGGGASAAA  120
PIRGIPIYNG PGGFPFLPPA AGGDGGHHQK LGFYGSYHPA TWPSSLGSTS PSPGAPPAPL  180
DPASAFLSPA AHHHHRMLSA SGRLNGMLSE TLLGYGGGGL GGIGGHHHHH HLHGAQPFGL  240
GSRFMPKLPA KRSMRAPRMR WTSTLHARFV HAVELLGGHE RATPKSVLEL MDVKDLTLAH  300
VKSHLQMYRT VKSTDKPAAS SGPNDGGSGD EDFPGAGQAA SGGDNMCGGA RPFGEHRSTS  360
EGAASSVGGG DMDQSSAGNT STTRWSNSSR DPWLSSNSCN MDAHRLAGLS SPIEVYIHSC  420
EWLLAVYQLR SPICASLIGM HVWACTIDVL MNSSICKCVH DVFQNAEPCR SSSSQVSNHE  480
LSSPSLEFTL GRPDWQGADH D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-16258312357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16258312357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16258312357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16258312357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.92492e-52callus
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and flowers. {ECO:0000269|PubMed:18594992}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.2NG323700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9253980.0EU925398.1 Zea mays milkweed pod1 (mwp1) mRNA, complete cds.
GenBankEU9546670.0EU954667.1 Zea mays clone 1476543 myb-like DNA-binding domain, SHAQKYF class family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956748.10.0probable transcription factor RL9
SwissprotQ0J2351e-152ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A368Q0M00.0A0A368Q0M0_SETIT; Uncharacterized protein
STRINGPavir.J41082.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.15e-49G2-like family protein