PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG035400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 712aa    MW: 79788 Da    PI: 10.393
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG035400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.28.8e-09253298146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          r +WT++E+ +l+  v++ G+ +W  Ia t+g++Rt+ qc  r+q 
  Pavir.2NG035400.1.p 253 REAWTAQEETKLLLIVQEKGMYNWINIAVTLGTHRTPFQCLVRYQR 298
                          789**************************************99995 PP

2Myb_DNA-binding46.58.2e-15307351248
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          ++WT+eEd++l  av+ +G + W ++++ +  gRt++qc +rw+k l
  Pavir.2NG035400.1.p 307 KAWTKEEDLQLQAAVETFGEK-WQLVSASLD-GRTGNQCSNRWRKTL 351
                          58*******************.*********.************975 PP

3Myb_DNA-binding37.36.3e-12359403247
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          grW  +Ed++l   vk+ G+g+W++Ia  ++ gRt  qc +rw++ 
  Pavir.2NG035400.1.p 359 GRWHMDEDKRLMVSVKLIGSGSWSRIAPFIP-GRTQTQCHERWRNI 403
                          89*****************************.************97 PP

4Myb_DNA-binding46.77.4e-15411454247
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          g+W +eEd +l+ av ++G+  W++Ia +++ gR +++c  rw+k+
  Pavir.2NG035400.1.p 411 GKWQPEEDSKLLAAVSEFGPC-WSKIALMIP-GRNDNMCSRRWNKL 454
                          79*****************88.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.529149245IPR017877Myb-like domain
SMARTSM007170.0013153249IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-11155172IPR009057Homeodomain-like
SuperFamilySSF466893.34E-5218261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.2E-11219260IPR009057Homeodomain-like
PROSITE profilePS500908.734248300IPR017877Myb-like domain
SuperFamilySSF466892.8E-22252347IPR009057Homeodomain-like
SMARTSM007172.1E-6252302IPR001005SANT/Myb domain
PfamPF002493.4E-6253298IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-12261306IPR009057Homeodomain-like
PROSITE profilePS5129418.805301355IPR017930Myb domain
SMARTSM007177.4E-13305353IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-16307353IPR009057Homeodomain-like
PfamPF002492.1E-13307350IPR001005SANT/Myb domain
CDDcd001673.30E-10308351No hitNo description
PROSITE profilePS5009010.29353404IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.1E-16356405IPR009057Homeodomain-like
SuperFamilySSF466896.24E-25356451IPR009057Homeodomain-like
SMARTSM007174.9E-8357406IPR001005SANT/Myb domain
PfamPF002491.2E-10359404IPR001005SANT/Myb domain
CDDcd001672.05E-7360404No hitNo description
PROSITE profilePS5129420.988405459IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.9E-18406458IPR009057Homeodomain-like
SMARTSM007171.2E-11409457IPR001005SANT/Myb domain
PfamPF002492.8E-13411454IPR001005SANT/Myb domain
CDDcd001673.46E-10412454No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MKPEASQGVH SELFADRNDD EFAAQKQNAK APNRTGFPKA ALLLVDALKK NRACQKLVRR  60
KLINIEAKIE ENKDLGDRVK CLLGYQLSCR KSTGRTLSQK EDPRVRLISS RKPTRLSEKN  120
NNRKMPALFL GPAENPHVSK YKMVLERFPM SFKKQPWSDV EKDKLARGIK QQYQETLILD  180
SLNNGSAIGD FSAVDMAYAL TNAAGNFEVT PESLRSVLPL INWDKISAMY LPGRPGAECE  240
SRWLNCDDPL INREAWTAQE ETKLLLIVQE KGMYNWINIA VTLGTHRTPF QCLVRYQRSL  300
NPHILNKAWT KEEDLQLQAA VETFGEKWQL VSASLDGRTG NQCSNRWRKT LHPTRTRVGR  360
WHMDEDKRLM VSVKLIGSGS WSRIAPFIPG RTQTQCHERW RNILDPNIYL GKWQPEEDSK  420
LLAAVSEFGP CWSKIALMIP GRNDNMCSRR WNKLCKHQLP AVKAAIQLKK SVFQTNFVDR  480
TKERPAIAPS DLIALVQSKD DGSGENTRDR SRKQTKENLA VSNIVNSSTA PDFVAADIVP  540
NTISRRPRRK STGQKSKKQT EENVAVPAGL NDLSSSCSRS RKRKSTTGSN ATVQKRMRGS  600
ISVDNEAVPI ELRGTDSANN EVGTNTIMDP VSVGEEGVVK KRTRHSKPAG SEGATRKRTC  660
SISADNEVGT NMMKDPVSGE EGVVKKRTRR SKPVGNEGAA KKKDEAFCPC W*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-272254523155MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-272254523155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1545549RPRRK
2579584SRKRKS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660280.10.0PREDICTED: uncharacterized protein LOC101780859
TrEMBLK3ZQN90.0K3ZQN9_SETIT; Uncharacterized protein
STRINGSi028919m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-146myb domain protein 4r1