PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG430400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 214aa    MW: 22302.5 Da    PI: 11.1222
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG430400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP123.49.8e-39110186278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          Cqve+C+adl +a++y+rrhkvCe hsk  +vlv+gl+qrfCqqCsrfhel efD +krsCrrrL++hn+rrr+++a
  Pavir.2KG430400.1.p 110 CQVERCAADLHDARRYYRRHKVCEPHSKELAVLVAGLRQRFCQQCSRFHELLEFDGDKRSCRRRLEGHNARRRRSSA 186
                          **************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-32105171IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.274107184IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.65E-36108188IPR004333Transcription factor, SBP-box
PfamPF031101.9E-30110183IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MRAKQASKRG SRTAPPPRRL SSIGSSPDGA AMDRKGTSSS AAASMAALAA AAAAGQGQPT  60
SGQANGALSS PHAEEDENPA TAAAVSGGGA SGSSDPVAAR RGAAGGGPSC QVERCAADLH  120
DARRYYRRHK VCEPHSKELA VLVAGLRQRF CQQCSRFHEL LEFDGDKRSC RRRLEGHNAR  180
RRRSSADRHG GSGGDQDGRS HPGNPSRNHF QIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-31104183584squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.79540.0callus| leaf| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.2KG430400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0966263e-73FP096626.1 Phyllostachys edulis cDNA clone: bphylf027p18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025799709.11e-90squamosa promoter-binding-like protein 13
TrEMBLA0A2S3H2I38e-89A0A2S3H2I3_9POAL; Uncharacterized protein
TrEMBLA0A2T7EWG93e-89A0A2T7EWG9_9POAL; Uncharacterized protein
STRINGPavir.Ba01146.1.p2e-96(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85243248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.13e-35squamosa promoter binding protein-like 5