PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG395300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 852aa    MW: 93558.8 Da    PI: 6.8841
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG395300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.46.9e-29534585152
               RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          aek++sl++l++yF++++kdAA++Lgvc+T+LKriCRq+GI RWP+Rkik++
  Pavir.2KG395300.2.p 534 AEKTVSLQVLRQYFAGSLKDAARSLGVCPTTLKRICRQHGITRWPSRKIKKV 585
                          5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.996524605IPR003035RWP-RK domain
PfamPF020422.4E-25537585IPR003035RWP-RK domain
SuperFamilySSF542776.54E-21742840No hitNo description
Gene3DG3DSA:3.10.20.2401.9E-24749834No hitNo description
PROSITE profilePS5174521.263753836IPR000270PB1 domain
SMARTSM006661.1E-17753836IPR000270PB1 domain
CDDcd064079.83E-40754834No hitNo description
PfamPF005645.7E-15754834IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 852 aa     Download sequence    Send to blast
MEGGGGDPQP SVSLQARTPS EGGAAVDLDL LEQLLSGDNG WFEVVSRSPN SLASPPPAAF  60
FSADVTATAA AATTQAASSW WIQTGGASPS SVRERFNQAL SYIRETQSDG DVLVQLWVPV  120
NRGDGQLVLT TSDQPFTLDQ RSDSLIRFRE VSTKYQFSAD VKSGDSPPGL PGRVFIGRLP  180
EWSPDIRYFT SYEYPRVRDA QHLDVHGTMG LPVFEKGSYN CLGVIELIMT RQKLNFTSEL  240
NTICSALQAV NLRSTEVSSV PRRQFSTASY KDALPEILEV LRAACLTHKL PLAQTWVTCA  300
QQGKRGSRHS DENYQYCIST IDEACFVNEP KMQDFHDACS EHHLLRGQGV AGKAFTTNQP  360
CFLPDIGSST KQEYPLSHHA KIFDLKGAVA IRLRCTRTGT ADFVLEFFLP TDCEALEEQK  420
AVLDSLSGTM RSVCQTLRVV TDKEMEDEAM WEMNELNSFT PQGKNKVEEL SFGGNSADRR  480
GEASWTSLAE TSQQESELAA LRMHGMFSSG GQGPSLSGVQ ATAEGSKTKR RTKAEKTVSL  540
QVLRQYFAGS LKDAARSLGV CPTTLKRICR QHGITRWPSR KIKKVDRSLR KLQQIIDSVH  600
GAETSFQLNT LYKDLTNTSI SSENNLSGSN TIPPTNQSNL TNFDKHQHHK SNSIVPSTSH  660
SHSSCSHNSD SSPSCSGGAT KHAPQVIIDL MKSGNPVKDS PIQTLQTENT SLYEHFSVNE  720
APKDLPQDVT EKANGGLHSK RSPSSPKQNA EANMRVKATF GSEKVRFRLN PECNFQELKH  780
EIAKRLSIVD TSSLILKYLD DDSEWVLMTY DADLQECLHV YKLADIQTIK ISVHLAVSPA  840
TRVTTGHTGL S*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.2KG395300.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9712710.0EU971271.1 Zea mays clone 360961 NIN-like protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025800526.10.0protein NLP1-like isoform X1
TrEMBLA0A2S3H1U80.0A0A2S3H1U8_9POAL; Uncharacterized protein
STRINGPavir.Bb02544.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein