PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG395300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 884aa    MW: 97189 Da    PI: 7.0765
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG395300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.37.3e-29566617152
               RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          aek++sl++l++yF++++kdAA++Lgvc+T+LKriCRq+GI RWP+Rkik++
  Pavir.2KG395300.1.p 566 AEKTVSLQVLRQYFAGSLKDAARSLGVCPTTLKRICRQHGITRWPSRKIKKV 617
                          5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.996556637IPR003035RWP-RK domain
PfamPF020422.5E-25569617IPR003035RWP-RK domain
SuperFamilySSF542776.87E-21774872No hitNo description
Gene3DG3DSA:3.10.20.2402.0E-24781866No hitNo description
SMARTSM006661.1E-17785868IPR000270PB1 domain
PROSITE profilePS5174521.263785868IPR000270PB1 domain
CDDcd064077.32E-40786866No hitNo description
PfamPF005646.0E-15786866IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 884 aa     Download sequence    Send to blast
MSPWFPSPRC AWRHGASPLH LQQGRNPESL TCMEGGGGDP QPSVSLQART PSEGGAAVDL  60
DLLEQLLSGD NGWFEVVSRS PNSLASPPPA AFFSADVTAT AAAATTQAAS SWWIQTGGAS  120
PSSVRERFNQ ALSYIRETQS DGDVLVQLWV PVNRGDGQLV LTTSDQPFTL DQRSDSLIRF  180
REVSTKYQFS ADVKSGDSPP GLPGRVFIGR LPEWSPDIRY FTSYEYPRVR DAQHLDVHGT  240
MGLPVFEKGS YNCLGVIELI MTRQKLNFTS ELNTICSALQ AVNLRSTEVS SVPRRQFSTA  300
SYKDALPEIL EVLRAACLTH KLPLAQTWVT CAQQGKRGSR HSDENYQYCI STIDEACFVN  360
EPKMQDFHDA CSEHHLLRGQ GVAGKAFTTN QPCFLPDIGS STKQEYPLSH HAKIFDLKGA  420
VAIRLRCTRT GTADFVLEFF LPTDCEALEE QKAVLDSLSG TMRSVCQTLR VVTDKEMEDE  480
AMWEMNELNS FTPQGKNKVE ELSFGGNSAD RRGEASWTSL AETSQQESEL AALRMHGMFS  540
SGGQGPSLSG VQATAEGSKT KRRTKAEKTV SLQVLRQYFA GSLKDAARSL GVCPTTLKRI  600
CRQHGITRWP SRKIKKVDRS LRKLQQIIDS VHGAETSFQL NTLYKDLTNT SISSENNLSG  660
SNTIPPTNQS NLTNFDKHQH HKSNSIVPST SHSHSSCSHN SDSSPSCSGG ATKHAPQVII  720
DLMKSGNPVK DSPIQTLQTE NTSLYEHFSV NEAPKDLPQD VTEKANGGLH SKRSPSSPKQ  780
NAEANMRVKA TFGSEKVRFR LNPECNFQEL KHEIAKRLSI VDTSSLILKY LDDDSEWVLM  840
TYDADLQECL HVYKLADIQT IKISVHLAVS PATRVTTGHT GLS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.2KG395300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9712710.0EU971271.1 Zea mays clone 360961 NIN-like protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025800526.10.0protein NLP1-like isoform X1
TrEMBLA0A2T8KRI30.0A0A2T8KRI3_9POAL; Uncharacterized protein
STRINGPavir.Bb02544.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55543852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein