PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG061400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CPP
Protein Properties Length: 777aa    MW: 83625.1 Da    PI: 6.6665
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG061400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.24.9e-16462500240
                  TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                           +k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  Pavir.2KG061400.1.p 462 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 500
                          589**********************************96 PP

2TCR50.25e-16547586140
                  TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  Pavir.2KG061400.1.p 547 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCESCKNTF 586
                          589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-17461502IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.046462587IPR005172CRC domain
PfamPF036388.8E-12464499IPR005172CRC domain
SMARTSM011143.5E-16547588IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11549585IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    Send to blast
MDTPDRAAAQ PPPASRAEDS PVFSFINNLS PIEPLKSAYN ANSLQGYQSI NITSISSIFT  60
SPHDNAHKET RLAKSSLGEI SESEACADGS KTNKPAKSSN AVRLFACAST VTRETRTVTC  120
SDAADPPTGP CDLAHPARFD NGSPDHNTTP CHGVRSDLKQ DKCRKLDVVQ TVKNTVEKRK  180
CLFSTEIQLL DGGQPVNGSD DVLGCQWSDL VSTTSGELLA FDSTMDDHHR GMHLAAKNAE  240
SCGYLLSKLT GGGEISDRAH PSASGQVYYQ ELVMGEDQTE NPQIFQDGQQ AISTEEIQDN  300
IYEENGCIPL DYKVESQQRG IRRRCLVFEA AGFSNTVVQK ETVESLSVST CKGKSHVQTQ  360
PRGLRGIGLH LNALALTPKG KMANQDPMAS GLHPSSGSEK DAHGKFLSAG ENFPNSGGDL  420
LEFPMDDCSA GSFPVNDHVS SQSVSPQKKR RKTDNNGDDG EACKRCSCKK SKCLKLYCEC  480
FAAGVYCSEP CSCQGCLNKP IHEEIVLSTR KQIEFRNPLA FAPKVIRMSD AGPETGEDPN  540
STPASARHKR GCNCKKSSCL KKYCECYQGG VGCSSNCRCE SCKNTFGRRD ADTELTEELK  600
QEGEQTENCG KEKENDQQKA NVQNEDHPLL ELVPITPPFD LSSSLLKLPN FSSAKPPRPS  660
KARSGNSRSS ASKATATLQS SKSSKVDGSV IDEEMPDILK EADSPNNCVK STSPNGKRVS  720
PPHNALSISP NRKGGRKLIL KSIPSFPSLM GESNSGSTMN DTDNTFSTSP LVLGPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-1546458412120Protein lin-54 homolog
5fd3_B3e-1546458412120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1447451KKRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.139120.0leaf| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.2KG061400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025799594.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A2S3GWC50.0A0A2S3GWC5_9POAL; Uncharacterized protein
STRINGPavir.Bb00411.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.15e-87TESMIN/TSO1-like CXC 2