PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG051800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB
Protein Properties Length: 887aa    MW: 98059.5 Da    PI: 10.5451
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG051800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.91.2e-08253298146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          r +WT++E+ +l+  v++ G+ +W  Ia t+g++Rt+ qc  r+q 
  Pavir.2KG051800.1.p 253 REAWTAQEETKLLLIVQEKGMYNWINIAVTLGTHRTPFQCLVRYQR 298
                          789**************************************99995 PP

2Myb_DNA-binding43.38.2e-14307351248
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          ++WT+eEd++l  av  +G + W ++++ +  gRt++qc +rw+k l
  Pavir.2KG051800.1.p 307 KAWTKEEDLQLQAAVGTFGEK-WQLVSASLD-GRTGNQCSNRWRKTL 351
                          58*******************.*********.************975 PP

3Myb_DNA-binding40.27.9e-13359403247
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          grW  +Ed++l  +vk+ G+g+W++Ia  ++ gRt  qc +rw++ 
  Pavir.2KG051800.1.p 359 GRWHMDEDKRLMVCVKLIGSGSWSRIAPFIP-GRTQTQCHERWRNI 403
                          89*****************************.************97 PP

4Myb_DNA-binding43.19.7e-14411454247
                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          g+W +eEd +l+ av ++G+  W++Ia +++ gR +++c  rw+k+
  Pavir.2KG051800.1.p 411 GKWRPEEDSKLLGAVSEFGPC-WSKIALMIP-GRNDNMCSRRWNKL 454
                          79*****************88.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.866149245IPR017877Myb-like domain
SMARTSM007171.5E-4153249IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-11155172IPR009057Homeodomain-like
CDDcd001670.0019218245No hitNo description
Gene3DG3DSA:1.10.10.601.0E-11219260IPR009057Homeodomain-like
PROSITE profilePS500908.734248300IPR017877Myb-like domain
SMARTSM007172.1E-6252302IPR001005SANT/Myb domain
SuperFamilySSF466897.34E-22252347IPR009057Homeodomain-like
PfamPF139211.4E-12256317No hitNo description
Gene3DG3DSA:1.10.10.603.7E-12261307IPR009057Homeodomain-like
PROSITE profilePS5129417.728301355IPR017930Myb domain
SMARTSM007176.5E-12305353IPR001005SANT/Myb domain
CDDcd001671.39E-9308351No hitNo description
Gene3DG3DSA:1.10.10.602.8E-16308353IPR009057Homeodomain-like
PROSITE profilePS5009010.22353404IPR017877Myb-like domain
SuperFamilySSF466893.3E-25356451IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-17356405IPR009057Homeodomain-like
SMARTSM007171.0E-8357406IPR001005SANT/Myb domain
PfamPF002491.4E-11359404IPR001005SANT/Myb domain
CDDcd001675.41E-8360404No hitNo description
PROSITE profilePS5129420.211405459IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-17406458IPR009057Homeodomain-like
SMARTSM007178.0E-11409457IPR001005SANT/Myb domain
PfamPF002492.5E-12411454IPR001005SANT/Myb domain
CDDcd001676.00E-10412454No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 887 aa     Download sequence    Send to blast
MKPEASQGGL SEPFADRNDD EFTAQKQNAK APNRTGFPKA ALLLLDALKK NRACQKLIRR  60
KLVNIEAKIE ENKDLGDRVK CLLGYQLSCR KSAGRTLSQK EDPRVRLISS RKPTRLSEKN  120
NNRKMPALFL GPAENPHVSK YKMVLEQFPM SFKKQPWSDV EKDKLARGIK QQYQETLILD  180
SLNNGSAIGD FSAVDMAYAL TNAAGNFEVT PESLRSVLPL INWDKISAMY LPGRSGAECE  240
SRWLNCDDPL INREAWTAQE ETKLLLIVQE KGMYNWINIA VTLGTHRTPF QCLVRYQRSL  300
NPHIMNKAWT KEEDLQLQAA VGTFGEKWQL VSASLDGRTG NQCSNRWRKT LHPTRTRVGR  360
WHMDEDKRLM VCVKLIGSGS WSRIAPFIPG RTQTQCHERW RNILDPNIDL GKWRPEEDSK  420
LLGAVSEFGP CWSKIALMIP GRNDNMCSRR WNKLCKHQLP AVKAAIQLKK SVFQTNFVDR  480
AKERPAIAPR DLIALVQSKD DGSGENTRDR SRKQTKENLA VSNIVDSSTA PDFVAADTVS  540
KTISRRPRKS TGQKSKKQTE ENVAVPDGLN DLSSGCSRSR KRKSTTASNA ALQKRMRGSI  600
SLDNEAVPIE LRGTDSANIE VGTNRIMDLV SVGEEGVVKK RTRCSKPARG NAAEQNIMAG  660
SIPVGNEAVP VELRGTVSTN NVVGTNTMMD PVSVGDEGVV KKRTRHSKPA GSEGEGATRK  720
RRCSISADNE VGTNMTKDPV SGEEGVVKKR TKRSKPVGNE GAARKKMRAS VPVGDEGAVK  780
KTGSVATENH GGVTKRKRAP SRRKSAGDNL TTEDVANASS ELGLPSTPSE ERVVDAANIN  840
KGRRKSTPRP KQIDMSEGDA DKHSPSTRLA NCLSFARMKG IDRNTR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-262254523155MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-262254523155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1578583SRKRKS
2700721KKRTRHSKPAGSEGEGATRKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.165532e-99callus| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660280.10.0PREDICTED: uncharacterized protein LOC101780859
TrEMBLA0A096QN110.0A0A096QN11_MAIZE; Uncharacterized protein
STRINGGRMZM2G051793_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-143myb domain protein 4r1