PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG528000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 386aa    MW: 42101.9 Da    PI: 8.0921
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG528000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.43e-2489132144
                  WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                          d+epgrCrRtDGKkWRC +++++++k+CE+H+hrg++rsrk++e
  Pavir.1NG528000.1.p  89 DPEPGRCRRTDGKKWRCAKEAYPDSKYCEKHMHRGKNRSRKPVE 132
                          79***************************************998 PP

2QLQ58.12.7e-201852236
                  QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                         +FTa+Q+q+L++Q+l+yK+La+++P+P++L+ +++
  Pavir.1NG528000.1.p 18 PFTASQWQELEHQALIYKCLASGKPIPSYLMPPLR 52
                         9******************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.1E-111753IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.6E-141850IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.8141853IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.82989133IPR014977WRC domain
PfamPF088794.6E-2090132IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MMMMSSRAGG GAGAGRYPFT ASQWQELEHQ ALIYKCLASG KPIPSYLMPP LRRILDSALA  60
TSPSLAFPPQ PSLGWGCFGM GFGRKPDEDP EPGRCRRTDG KKWRCAKEAY PDSKYCEKHM  120
HRGKNRSRKP VEMSLATPAP SSNATSANSA TANATTTSSP APTYHRPAPA PAAAHDAAPY  180
HALYCGSPYV ASTRPGGAYH AAAQVSPFHL HLDTTHPHPP PSYYSVDQRD YAYGHAAAKE  240
VGEHAFFSDG TAERDRQAAG QWQFRNLGAE PKPSATSLFS VGGYGNGAAT VPYAVDRIKE  300
EDEEERRRQQ QHCFVLGADL RLERPSGHDA APEQKPLRPF FDEWPHEKSN KGGSWMGLDG  360
ETQLSMSIPM ATNDLPITSR YRNDE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.73790.0callus| root
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.1NG528000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9702921e-179EU970292.1 Zea mays clone 343148 atGRF5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954097.10.0growth-regulating factor 1 isoform X1
SwissprotQ6AWY81e-167GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLA0A2T7FCW60.0A0A2T7FCW6_9POAL; Uncharacterized protein
STRINGPavir.J03212.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-49growth-regulating factor 5