PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG451300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Dof
Protein Properties Length: 277aa    MW: 29074.1 Da    PI: 8.3338
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG451300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.86.4e-4042102262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++s
  Pavir.1NG451300.1.p  42 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRAS 102
                          7899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-304096IPR003851Zinc finger, Dof-type
PfamPF027012.6E-3343100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.22746100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MMAAAPPVHI CMDSDWLKGI VPEEPGMGSS SPPADRRLRP QHDQPLKCPR CESTHTKFCY  60
YNNYSLSQPR YFCKTCRRYW TKGGSLRNVP VGGGCRKNKR ASAKKPAAPP MLQAHARQVA  120
ETGLHLSFSS MQQLPPPPAA ADPLCSLGLL DWKYDPILAG SGGAAGALDG ASSEAHFAGA  180
GMMGIPGGGE CHALSALRYA AGLGDHLQLQ GLPFGARAEH DAVEVKPAAA ERLLSLDWYG  240
EASRAPESAI SSLGALGLWS GMIGGAHQHH GSSAAI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.72718e-53callus
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.1NG451300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0353260.0BT035326.1 Zea mays full-length cDNA clone ZM_BFb0055G17 mRNA, complete cds.
GenBankBT0629570.0BT062957.1 Zea mays full-length cDNA clone ZM_BFc0012J21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953626.11e-175dof zinc finger protein 1
TrEMBLK3YUL61e-174K3YUL6_SETIT; Uncharacterized protein
STRINGPavir.Aa00993.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.14e-38Dof family protein