PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG419000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 216aa    MW: 25293.7 Da    PI: 6.7917
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG419000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.78.6e-2793143252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          ++ +++e +s+y s+pik+AA+eL+v+lTvLK++CR++GI+RWPhRk+ksl
  Pavir.1NG419000.1.p  93 KQGLTFELVSRYLSMPIKQAARELNVGLTVLKKRCRELGIPRWPHRKVKSL 143
                          6789*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.7880164IPR003035RWP-RK domain
PfamPF020421.6E-2196143IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MEELRFYEKG YRYYHGLKLH EDEGYFQFQD FSADYLLGEE THLCAISFPE SSFSQEELGC  60
LSEVDFASFW ALVEEEDARR KSDEGPRSGP GKKQGLTFEL VSRYLSMPIK QAARELNVGL  120
TVLKKRCREL GIPRWPHRKV KSLQTLIDNV QELGRPNAQE DGHQTRSLVE RLQRTKKLIE  180
ERPEVMLDEE TKELRQACFK ETFKRRRLLG HGTYW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203207KRRRL
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.1NG419000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822796.11e-129protein RKD1
SwissprotQ9M9U92e-37RKD1_ARATH; Protein RKD1
TrEMBLA0A2S3GTB41e-128A0A2S3GTB4_9POAL; Uncharacterized protein
STRINGPavir.Aa00708.1.p1e-155(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.16e-40RWP-RK domain-containing protein