PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG180100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 486aa    MW: 53115.4 Da    PI: 4.5488
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG180100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK52.11.3e-16377422752
               RWP-RK   7 ledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          +ed+    +++ kdAAkeL++++T LKr CR+++ +RWP Rki s+
  Pavir.1NG180100.1.p 377 MEDVLDRMHMSKKDAAKELNISATSLKRLCRKNNTNRWPGRKIMSI 422
                          57777889***********************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.924360443IPR003035RWP-RK domain
PfamPF020421.1E-15377422IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MADESYDIDG DVSRFLQTPP PESHPLAVAA PDDDEPVAPH VGAPQDAPAV VQVGVALQTP  60
PLNPDPAPAN VENRQAPTMD VGPPPPCDLA PAALAPTDPA SSFEALFADI VLPDLGTMSL  120
YDEFMDDEDN DEVDQALIRS IEDAGNADIS SALAEHTAVP PAEEDLDFVP FVRGQLDCSN  180
CRSIREVLHE SANRKLHFTV HVADPGTFQH AVFDRTYIDA YGQIILNEMC YLDLRQRMHE  240
WVQEFIANTV EMLKEDTSGQ PKDSCSTKDA STPADYDAHR ELELDMLKHI FSSPTDAPTE  300
AVAPQFTPEA PQPATRAEEN IINPDGILFG TANQREPGLS RPAILESFQV AAQDGASGTS  360
ASHLPAKQRK RMSGFPMEDV LDRMHMSKKD AAKELNISAT SLKRLCRKNN TNRWPGRKIM  420
SINNKIKKLE EAAHKHVGMI GLLAFKEKLD KLKLERAQLY SSFVRDMQEN EKHNGGWGAG  480
SSGSK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.1NG180100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444338.11e-150uncharacterized protein LOC8070087
TrEMBLA0A3L6RPH10.0A0A3L6RPH1_PANMI; Uncharacterized protein
STRINGPavir.J15709.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144291012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38340.11e-09Nin-like family protein