PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG071900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 451aa    MW: 47418.2 Da    PI: 7.3218
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG071900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.79.4e-40205281177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +Cq egC+adls ak+yhrrhkvCe h+ka++v+++g++qrfCqqCsrfh l efD++krsCr+rL +hn+rrrk++
  Pavir.1NG071900.1.p 205 RCQGEGCKADLSAAKHYHRRHKVCEYHAKAATVAAAGKQQRFCQQCSRFHVLAEFDDAKRSCRKRLTEHNRRRRKPA 281
                          6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-32198267IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.633203280IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-36204281IPR004333Transcription factor, SBP-box
PfamPF031105.9E-30206279IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MASSSRLMMM STNTMAGLTN DVDFSFGAMQ AQPFAGFDAG AMAMPSVERP PLLQHHHNSH  60
LYDIFDLAAA GFPFQEPGLL PPTSLPLPPS MEMAMPPSPL QMPLPAGVLT AAEVYPFGGA  120
GGTAAAAAFL KREDGHHQLA DAGGGGGGTI GLNLGRRTYF SPADVLAVDR LLARSRLGGG  180
VGLGIGVLGL RLGAAHHHHH QQPPRCQGEG CKADLSAAKH YHRRHKVCEY HAKAATVAAA  240
GKQQRFCQQC SRFHVLAEFD DAKRSCRKRL TEHNRRRRKP AGAQGKDSPP PPPKRAADTC  300
IISTSYSSDH HKSASATAEV KSTALSPTNG SGGVSCLDAV DNGHTSSAAA PTALSLAALP  360
PLHDEEKDGG SGLDSMLMRQ VQVRDDHDDD DHRRFMTSLA MQQQEHQHDG GSGGHGGHDG  420
VGGGGNILSC PPVSDHRNGG CNGFFEMDFI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-272062791184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1262279KRSCRKRLTEHNRRRRKP
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.1NG071900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0116141e-122AJ011614.1 Zea mays mRNA for SBP-domain protein 1.
GenBankEU9668911e-122EU966891.1 Zea mays clone 297975 SBP-domain protein 1 mRNA, complete cds.
GenBankKJ7280091e-122KJ728009.1 Zea mays clone pUT6144 SBP transcription factor (SBP10) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025798015.11e-179squamosa promoter-binding-like protein 5
SwissprotQ0E3F83e-71SPL5_ORYSJ; Squamosa promoter-binding-like protein 5
TrEMBLA0A2S3GLW21e-178A0A2S3GLW2_9POAL; Uncharacterized protein
STRINGPavir.Ab00520.1.p1e-160(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.13e-32squamosa promoter binding protein-like 8