PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG030400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 511aa    MW: 54173.9 Da    PI: 6.1999
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG030400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.74.7e-28269318251
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
                          ek++sle+l++yFs+++kdAA++Lgvc+T++KriCRq+GI+RWP+Rki++
  Pavir.1NG030400.1.p 269 EKTVSLEVLQRYFSGSLKDAARSLGVCPTTMKRICRQHGISRWPFRKIAK 318
                          799*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.757255339IPR003035RWP-RK domain
PfamPF020421.3E-24271318IPR003035RWP-RK domain
SuperFamilySSF542773.6E-19403472No hitNo description
SMARTSM006661.0E-18405498IPR000270PB1 domain
PROSITE profilePS5174518.634405498IPR000270PB1 domain
PfamPF005641.3E-14406495IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.7E-23406473No hitNo description
CDDcd064071.54E-31406474No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MSEVSDVLTT VGEAHRLPLA QAWVRCKRCN TSTEHASLTA AGTPFYLASD ADQSLIGFRE  60
ACVEHHLRAG RGGLVEEAAA ARGPLFCADV TKYSMDAYPL AHHARFCGLA GCLAVCVQLR  120
RDHDDDASMD DGSREQCVLE FFLPPDCRDG AAQKAAADAI AATLTQRFGN GHLKAIAISW  180
LQDLAFEIVA DGECVLRHDR VVMVDAPELE LNDHGGDERD SDEEGLHLAT AVGAADIETP  240
KMNDGGENGG EDPRSQAGEK KKKAKRKGEK TVSLEVLQRY FSGSLKDAAR SLGVCPTTMK  300
RICRQHGISR WPFRKIAKAN RSLDKIKRVF ESVPGSTNPM AAPTPAAAVS HQAPAAATAR  360
GGHALPCLSS ALRVTSSQGS CQAPPPPNPK DAALRTPLHG ADAGVVTVKA SYRGDIVRFR  420
VPSSAGVATV KGEVAKRLGL EASEFDVKYL DDDNEWVLLS CDADFQECLE VVPAVSGASS  480
SSGSASPQPV VRLMVQEVPE NHGSSCGSSD *
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.1NG030400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025823617.10.0protein NLP3-like
TrEMBLA0A2S3GLE70.0A0A2S3GLE7_9POAL; Uncharacterized protein
STRINGPavir.Aa03213.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62692939
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.19e-59Nin-like family protein