PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1NG028400.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 471aa    MW: 50475.2 Da    PI: 9.217
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1NG028400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1308.3e-41177253278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          CqvegC+ dls+ak+yhr+hkvCe+hskap+v+v+g+e+rfCqqCsrfh l+ fD++krsCrrrL++hn+rrrk+q+
  Pavir.1NG028400.2.p 177 CQVEGCKIDLSSAKDYHRKHKVCEAHSKAPKVVVAGVERRFCQQCSRFHGLDLFDQKKRSCRRRLNDHNARRRKPQP 253
                          **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.5E-33170238IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.787174251IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-38175256IPR004333Transcription factor, SBP-box
PfamPF031101.3E-31177250IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010358Biological Processleaf shaping
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MSSFGMDWNQ KGSVLWDWEN LPLIGTSGSE SAKAIATQAE AKFSATEVTR HGSVHSSCGT  60
FSSNSEMGYG SSKSSISASI DSSPKTGKNM ELNFAPARVS DKNTVLGKVY DARTSPSSVI  120
AVSSGEPVLS LKLGKRTYFE DVCGGQSVKS SPSDTSAVTP ALVKKAKAAQ NAQNTYCQVE  180
GCKIDLSSAK DYHRKHKVCE AHSKAPKVVV AGVERRFCQQ CSRFHGLDLF DQKKRSCRRR  240
LNDHNARRRK PQPEAISFGS SRLSAMFYDA RQQTTLHFGQ APYGQMRSCA SSSWDNPGGA  300
FKFAETKAPW LKPARAAGID ALHLSSQQVW NNIMPHGGHQ DFDGFMGFKG TSAKVLNQGV  360
EASAAISDSN GNPDLQRALS LLSNNSAGAG NNHPTTQPHP GLSTLASTSN TVMQASSQGL  420
WQDGTALDLH ARFQALDPLG SGSAIPTTHE VQLPKPSLFD DSSSHYDLMH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-261772501184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1232249KKRSCRRRLNDHNARRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.47670.0callus| leaf| root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.1NG028400.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025826432.10.0squamosa promoter-binding-like protein 3
RefseqXP_025826439.10.0squamosa promoter-binding-like protein 3
RefseqXP_025826447.10.0squamosa promoter-binding-like protein 3
SwissprotA2X0Q61e-175SPL3_ORYSI; Squamosa promoter-binding-like protein 3
SwissprotA3A2Z81e-175SPL3_ORYSJ; Squamosa promoter-binding-like protein 3
TrEMBLA0A2S3GL660.0A0A2S3GL66_9POAL; Uncharacterized protein
STRINGPavir.Aa03225.1.p0.0(Panicum virgatum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.42e-41squamosa promoter binding protein-like 10