PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG509000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 171aa    MW: 19762.8 Da    PI: 9.7966
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG509000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.81.1e-284897352
               RWP-RK  3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                         ke+++e +s+yFs+pik+AA+eL+v+lTvLK++CR++GI+RWPhRk+ksl
  Pavir.1KG509000.1.p 48 KELTFELVSRYFSMPIKQAARELNVGLTVLKKRCRELGIPRWPHRKVKSL 97
                         89**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.62227117IPR003035RWP-RK domain
PfamPF020422.8E-235097IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MFLLYPVNAE ALGCPSEVDF ASFWALVEEE ENARRKSEGG PRSGPGRKEL TFELVSRYFS  60
MPIKQAAREL NVGLTVLKKR CRELGIPRWP HRKVKSLQTL IDNVQELGKP TAQEDGHLTR  120
SLVERLQRTK KLIEERPEVL LDEETKELRQ ACFKEAFKRR RLLLTHGTYW *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157161KRRRL
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.1KG509000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822796.16e-96protein RKD1
SwissprotQ9M9U98e-38RKD1_ARATH; Protein RKD1
TrEMBLA0A2S3GTB41e-94A0A2S3GTB4_9POAL; Uncharacterized protein
TrEMBLA0A2T7FBK31e-94A0A2T7FBK3_9POAL; Uncharacterized protein
STRINGPavir.Ab02992.1.p1e-115(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-40RWP-RK domain-containing protein