PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG449300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 622aa    MW: 64142.5 Da    PI: 8.7706
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG449300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS298.22.1e-912576212374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL e+A a+++gd ++a a La l++ a+p+gd+ qRl+a+++ A+++r+ +         ++++ ++   +e+ aa +l+++vsP++
  Pavir.1KG449300.1.p 257 RQLLSEAAAAMADGDRAAAAAHLAALKTAANPRGDAEQRLVAMMAAAMSSRIGS--------PSSQQLADLCGAEQRAACHLLHDVSPCF 338
                          689**************************************************9........344444444488888999********** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfe 177
                           ++   aN aIl+av+g++ +H iDfd+s  +Q +aL++aLa+R+     l++T+v++p+s      +++l +tg+rL++ A++ g++f+
  Pavir.1KG449300.1.p 339 GLALHGANLAILDAVAGQRVIHLIDFDVSL-AQHIALIHALANRRVAGTCLKLTAVADPTSPftpaLAQALAATGQRLQRHAQQAGLEFR 427
                          ****************************98.69*************************9988899999********************** PP

                 GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                          fn+ v+ r  +++ ++L ++pgEa+aVnl+++l r++desvs +++rde+L+ v+ l P+vv +veqe+++n++++++rf++a+ +y a+
  Pavir.1KG449300.1.p 428 FNA-VSCRPGEVDASRLGCEPGEAVAVNLAFALSRVPDESVSPANPRDELLRRVRALGPRVVALVEQELNTNTAPLAARFADACAHYGAV 516
                          ***.68899********************************************************************************* PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          ++sl+a+l+r+s +r+  E++ l+ ++ n+va eg +r er+e ++kWr+r+++aG++p+++++ +a+ +k+ l +    g+ v+ e g 
  Pavir.1KG449300.1.p 517 LESLDATLARDSVQRARAEAA-LAGKAANAVAREGPDRLERCEVFGKWRARFGMAGLRPLAIGQGVADRVKARLGHAR-PGFDVKLEGGR 604
                          *********************.888999**********************************************9998.9********** PP

                 GRAS 358 lvlgWkdrpLvsvSaWr 374
                          l  gW++r ++++SaWr
  Pavir.1KG449300.1.p 605 LGVGWMGRVVTVASAWR 621
                          ****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.092230602IPR005202Transcription factor GRAS
PfamPF035147.4E-89257621IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MDPAWCDPRR GYAYGYGVGS AAQAPPARRQ SQQDAAAGAT GGVLKRNLAE VERWQQALQR  60
VAAQAQGAHP PIDVGAVLAR AASRGSSFSG PPSGGFAGHS PQPSSTLSSL TTASRMATPA  120
AAAAMQQLLQ RQVVAAPPAP LQPARAVAGG PAARPATARE MVLLQELEKE LLCDDDNAEA  180
EAEGSACGST VTTSAWGNTM QELNSITAPP LPSLPMARAT TNYTSVPVSR SPANSASSST  240
ASSTSSSSPP TSAASSRQLL SEAAAAMADG DRAAAAAHLA ALKTAANPRG DAEQRLVAMM  300
AAAMSSRIGS PSSQQLADLC GAEQRAACHL LHDVSPCFGL ALHGANLAIL DAVAGQRVIH  360
LIDFDVSLAQ HIALIHALAN RRVAGTCLKL TAVADPTSPF TPALAQALAA TGQRLQRHAQ  420
QAGLEFRFNA VSCRPGEVDA SRLGCEPGEA VAVNLAFALS RVPDESVSPA NPRDELLRRV  480
RALGPRVVAL VEQELNTNTA PLAARFADAC AHYGAVLESL DATLARDSVQ RARAEAALAG  540
KAANAVAREG PDRLERCEVF GKWRARFGMA GLRPLAIGQG VADRVKARLG HARPGFDVKL  600
EGGRLGVGWM GRVVTVASAW R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3827162118375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.71120.0callus| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9570740.0EU957074.1 Zea mays clone 1581966 chitin-inducible gibberellin-responsive protein 2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953458.10.0PREDICTED: scarecrow-like protein 8
TrEMBLK3YQT30.0K3YQT3_SETIT; Uncharacterized protein
STRINGSi016627m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.13e-80SCARECROW-like 8