PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG354000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bZIP
Protein Properties Length: 306aa    MW: 33315.2 Da    PI: 8.1161
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG354000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1248.2e-081722211463
                          HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  14 ReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          R + +rsR RK+++i+eLe+ v++L++   +L+ ++ +l ++  +l +e+
  Pavir.1KG354000.1.p 172 RRSGQRSRVRKLQYIAELERTVDSLQNMGADLAVRVASLCQLHNSLSMEN 221
                          67889******************************999999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147035.80E-16171215No hitNo description
Gene3DG3DSA:1.20.5.1703.6E-5172224No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MSRSPHLPPR CPPLGPQITR RDDSLFTQSC RFPSGDPFIG EPPCWLDDLL ADSGKVPNFP  60
PLRRAFPDSS NRGRDLSPGG EAEDLLDAVE GGESGSVVEA SCVYGPNSPR QKSRLTTSES  120
SMVNAVLENV PSNPLQYLTI DASSGVNGNM TNGTADANDV YGNPDQDKTF KRRSGQRSRV  180
RKLQYIAELE RTVDSLQNMG ADLAVRVASL CQLHNSLSME NKQLRIQIST LQHAKLIKDG  240
QTQALKNEAE RLKQVSTRHR RSRSVTSCYN PSPYGDASPV NWQMPDMAKL SLDGSSVSPR  300
GGYGL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171177RRSGQRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.50890.0callus| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0557880.0BT055788.1 Zea mays full-length cDNA clone ZM_BFb0187P01 mRNA, complete cds.
GenBankBT0684150.0BT068415.1 Zea mays full-length cDNA clone ZM_BFb0176P14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025815126.10.0basic leucine zipper 2
TrEMBLK3YU630.0K3YU63_SETIT; Uncharacterized protein
STRINGSi017809m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81372631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.13e-17bZIP family protein