PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG260900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 412aa    MW: 45123.8 Da    PI: 5.1992
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG260900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK50.34.7e-16304349752
               RWP-RK   7 ledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          +ed+ +  +++ kdAAkeL++++T LKr CR+++ +RWP Rki s+
  Pavir.1KG260900.1.p 304 MEDVLNRMHMTKKDAAKELNISATSLKRLCRKNNTNRWPGRKIISI 349
                          57788899***********************************885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.97287369IPR003035RWP-RK domain
PfamPF020422.9E-15304348IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MDVEPPPLPP PCDLVAPAAL ATTDPTPSFE ALFDDIVLPD LGTMSLYDEF MDDGDDEVDA  60
LIRSVEDASN TDMTTALAEH PAVHPAEEDF VPFVRGQLDC SNCRSVREVL HESANHKLHV  120
AIHVVADHGT FQHAVFDRTY IDADGQIILN EMSYLDLRQR THEWVKEYVA NTVEMLKEDT  180
SGQLKDYACS PFHSAVCTNA STAADNDPHR ELELDMLKHI FSSPTAPTEA VAPPDEAPQP  240
ATRAEENIVN PDGILFGAAN WRGAVLSRPA ILESFQVAVQ DGVSGTSASH LPAKQRKRMS  300
GFPMEDVLNR MHMTKKDAAK ELNISATSLK RLCRKNNTNR WPGRKIISIN NKIKKLEEAA  360
HKNVGVRGLL AFKEKIDKLK IERAQLYSSF VGGLQETEKH NGGGAGSSGS K*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.1KG260900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444338.11e-128uncharacterized protein LOC8070087
TrEMBLA0A3L6RPH10.0A0A3L6RPH1_PANMI; Uncharacterized protein
STRINGPavir.Ab01364.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144291012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38340.12e-06Nin-like family protein