PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG043600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family SBP
Protein Properties Length: 472aa    MW: 50667.5 Da    PI: 8.9297
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG043600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.3e-41178254278
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                          CqvegC+ dls+ak+yhr+hkvCe+hskap+v+v+gle+rfCqqCsrfh l+ fD++krsCrrrL++hn+rrrk+q+
  Pavir.1KG043600.1.p 178 CQVEGCKIDLSSAKDYHRKHKVCEAHSKAPKVVVAGLERRFCQQCSRFHGLDLFDQKKRSCRRRLNDHNARRRKPQP 254
                          **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-33171239IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.812175252IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-38176257IPR004333Transcription factor, SBP-box
PfamPF031101.8E-31178251IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MGSFGMDWNQ KGSVLWDWEN LPLIGTSGNE SAKMIATQAE AKFSAAEVTR HGSVHSSCGT  60
FSSNSEMGYG SSKSSISASI DSSPKVGKNM ELNFAPARVS DKNTVLVKVD DARTSPSSVI  120
AVSSGELVLS LKLGKRTYFE DVCGGQSVKS SPSDTSTVTP PALVKKAKAA QNAQNTYCQV  180
EGCKIDLSSA KDYHRKHKVC EAHSKAPKVV VAGLERRFCQ QCSRFHGLDL FDQKKRSCRR  240
RLNDHNARRR KPQPEAISFG SSRLSAMFYD ARQQTTLHFG QVPYGQMRSC TSSSWDNPGG  300
AFKFAETKAP WLKPARAAGI DGLHLSSQQV WNNIMPHGGH QDFDGFMGFN GTSAKILNQG  360
DEASASVSNS NGNPDLQRAL SLLSNNSAGA GNNHPTTQLH PGLSTLASTS NAVMQASSPG  420
LWQDGTALDL HARFQALDPL GSGSAIPTTH EVQLPKPSLF DDSSSHYDLM H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-271782511184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1233250KKRSCRRRLNDHNARRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.47670.0callus| leaf| root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.1KG043600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025826432.10.0squamosa promoter-binding-like protein 3
RefseqXP_025826439.10.0squamosa promoter-binding-like protein 3
RefseqXP_025826447.10.0squamosa promoter-binding-like protein 3
SwissprotA2X0Q61e-178SPL3_ORYSI; Squamosa promoter-binding-like protein 3
SwissprotA3A2Z81e-178SPL3_ORYSJ; Squamosa promoter-binding-like protein 3
TrEMBLA0A2S3GL660.0A0A2S3GL66_9POAL; Uncharacterized protein
STRINGPavir.Ab00358.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36973776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.33e-38squamosa promoter binding protein-like 2