PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG040700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family Nin-like
Protein Properties Length: 513aa    MW: 54303.1 Da    PI: 5.4905
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG040700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.74.8e-28271320251
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
                          ek++sle+l++yFs+++kdAA++Lgvc+T++KriCRq+GI+RWP+Rki++
  Pavir.1KG040700.1.p 271 EKTVSLEVLQRYFSGSLKDAARSLGVCPTTMKRICRQHGISRWPFRKIAK 320
                          799*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.632256341IPR003035RWP-RK domain
PfamPF020421.3E-24273320IPR003035RWP-RK domain
SuperFamilySSF542775.56E-19404472No hitNo description
SMARTSM006664.8E-17405498IPR000270PB1 domain
PROSITE profilePS5174518.725405498IPR000270PB1 domain
PfamPF005642.3E-14406475IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.9E-23406472No hitNo description
CDDcd064074.08E-31406473No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MSEVSDILTT VGEAHRLPLA QAWVRCKRCN TSTEHAATLT AAGTPFYLAG DADQILIGFR  60
EACVEHHLRP GRGGLVEEAA AARGPRFCAD VTKYSMDAYP LAHHARFCGL AGCLAVCVQL  120
RRGDDDDDAS MDDGSREQCV LEFFLPTDCR DGAAQKAAAD AVAATITELF GDGHLKAITI  180
SGLQDLAFEI VADGECVLRH DGVVMADAPE LELNDHGGDE RDSDEEGLHL ATAVGAADIE  240
APKMNDGDEN GDKDPRSQIV EEKKKAKRKG EKTVSLEVLQ RYFSGSLKDA ARSLGVCPTT  300
MKRICRQHGI SRWPFRKIAK ANRSLDKIKR VFESVPGSTN PMTASTAAAA VSHQAPAAAT  360
ARGGPALPCL SSALRVTSSQ GSCQAPPPPR DAALRTPLRG VDAGVVTVKA SYRGDIVRFR  420
VPSSAGVATV KGEVAKRLGL EASEFDVKYL DDDNEWVLLS CDADFQECLE VVPAVSGAAS  480
SSGSALAQPV VRLMVQEAPE NHGSSCAVQS SH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPavir.1KG040700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025823617.10.0protein NLP3-like
TrEMBLA0A2S3GLE70.0A0A2S3GLE7_9POAL; Uncharacterized protein
STRINGPavir.Ab00331.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62692939
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.11e-53Nin-like family protein