PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.T158300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 355aa    MW: 39505.4 Da    PI: 6.674
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.T158300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.11e-17243277135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Potri.T158300.1 243 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 277
                      99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.4E-7217333IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.097237273IPR000679Zinc finger, GATA-type
SMARTSM004013.7E-16237287IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-15240301No hitNo description
Gene3DG3DSA:3.30.50.103.2E-14241275IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.95E-14242289No hitNo description
PfamPF003201.3E-15243277IPR000679Zinc finger, GATA-type
PROSITE patternPS003440243268IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MEAPEFYGAS GFFSSQFTSN EKHHSLDSNN KSIGGGDHFI VEDLLDFSNE DDDAMITDPN  60
NNNTIVTATT NSTDSSTVTV VDSCNSSSFS GREPSSFNGD IGSHHTNNFS HHDVHLGSEL  120
CVPYDDLAEL EWLSNFVEES FSSEDLQRLQ LISGMKARPD ESSKSRHFRT HGDTDDNNNG  180
DVSNISNINN TMFNPETAVP AKARSKRSRA APGNWASRLL TIKVEARQKK RDGGVEGCDG  240
RKCLHCATDK TPQWRTGPMG PKTLCNACGV RYKSGRLVPE YRPAASPTFM LTKHSNSHRK  300
VLELRRQKEM VRAQQQHQHQ QFLHHHQNMV FGVSNGGDDY LIHQHVGPDF RQMI*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vascular cylinder of roots. Expressed in the differentiation zone of the root stele. {ECO:0000269|PubMed:25265867}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.T158300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024445864.10.0GATA transcription factor 12-like
SwissprotP697814e-88GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A2K1WVS50.0A0A2K1WVS5_POPTR; GATA transcription factor
STRINGPOPTR_0018s08090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.16e-77GATA transcription factor 12
Publications ? help Back to Top
  1. Ravindran P,Verma V,Stamm P,Kumar PP
    A Novel RGL2-DOF6 Complex Contributes to Primary Seed Dormancy in Arabidopsis thaliana by Regulating a GATA Transcription Factor.
    Mol Plant, 2017. 10(10): p. 1307-1320
    [PMID:28917589]