PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.T127400.1
Common NamePOPTR_0011s13460g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 108aa    MW: 12613.5 Da    PI: 8.3291
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.T127400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS123.62.4e-381106267373
             GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                      +f+s+++ lpr+++eri+vE+++l+r+ivnv+aceg+er+erhe ++kW++r+++aGF++ pls+++++ +++llr ++ + y++ e +g+++l
  Potri.T127400.1   1 MFESIDVRLPRNQKERISVEQHCLARDIVNVIACEGKEREERHELFGKWKSRFMMAGFRQCPLSSYVNSVIRSLLRCYS-EHYTLVEIDGAMLL 93 
                      7**************************************************************************9999.66************ PP

             GRAS 361 gWkdrpLvsvSaW 373
                      gWkdr+L+s+SaW
  Potri.T127400.1  94 GWKDRNLISASAW 106
                      ************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098518.11188IPR005202Transcription factor GRAS
PfamPF035148.1E-361106IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 108 aa     Download sequence    Send to blast
MFESIDVRLP RNQKERISVE QHCLARDIVN VIACEGKERE ERHELFGKWK SRFMMAGFRQ  60
CPLSSYVNSV IRSLLRCYSE HYTLVEIDGA MLLGWKDRNL ISASAWY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317558.12e-72hypothetical protein POPTR_0011s13460g
SwissprotQ69VG13e-56CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLB9I0722e-72B9I072_POPTR; Uncharacterized protein
STRINGPOPTR_0011s13460.15e-72(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1489644
FabidsOGEF3693022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04890.11e-48SCARECROW-like 21