PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.T124600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 284aa    MW: 32492 Da    PI: 7.5513
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.T124600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR183.53.5e-26118206290
             FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                      fY+eYA+++GF +r+ + ++s+r+g+i  r++ C+keg+  + + k  + r++r++tr gCka+++vk +k+gkw++tk++++HnH+l+
  Potri.T124600.1 118 FYDEYARRIGFVMRVMSCRRSERDGRILARRLGCNKEGYCVSIRGKFGNVRKPRPSTREGCKAMIHVKFDKSGKWVITKFVKDHNHPLV 206
                      9**************************************999999989***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.1E-24118206IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MIKTTCCQIY SSLSGGIKTL EFHDHLSLDS DPSYPYSPKP KNTSLNSRNY LPYPSQFRVS  60
LIFAASMDVD ERIDIAESSI GNELVEHGGE LVEHEGDDMV VEPHEGMEFE SEDAAKIFYD  120
EYARRIGFVM RVMSCRRSER DGRILARRLG CNKEGYCVSI RGKFGNVRKP RPSTREGCKA  180
MIHVKFDKSG KWVITKFVKD HNHPLVVAPR EARQTLDEKD KKIQELTAEL RNKKRLCATY  240
QEQLSAFVKI VEDHSEKLSK KVKNAVENLK EFESIEQELM QHT*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.T124600.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2146280.0AC214628.1 Populus trichocarpa clone POP040-F15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024444552.11e-159protein FAR1-RELATED SEQUENCE 5
RefseqXP_024448822.11e-159protein FAR1-RELATED SEQUENCE 5-like
SwissprotQ9SZL83e-28FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A3N7G3V31e-158A0A3N7G3V3_POPTR; Uncharacterized protein
STRINGPOPTR_0017s05820.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96531104
Representative plantOGRP3376727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.11e-112FAR1 family protein
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]