PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.T124200.1
Common NamePOPTR_0017s05780g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 251aa    MW: 28553.2 Da    PI: 7.0197
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.T124200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR192.74.8e-2986173291
             FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                      fYn+YA+++GF +r+sk ++s+r+g+ + r +vC+keg+r ++k++  k  r+raetr+gC+a++ v+k ++gkwevtk+++eH+H+l+p
  Potri.T124200.1  86 FYNAYATRIGFVIRVSKLSRSRRDGSAIGRALVCNKEGFRMPDKRE--KIVRQRAETRVGCRAMILVRKASSGKWEVTKFVKEHTHSLTP 173
                      ******************************************9988..9**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.5E-2686173IPR004330FAR1 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MDFIVDNDAN GDIAGNVAVD IARARDENEI VENSVEGEFE QYDHKMDKES LAIDMIPDAV  60
PAMSMVAADE PYMGQEFDSE ASAHAFYNAY ATRIGFVIRV SKLSRSRRDG SAIGRALVCN  120
KEGFRMPDKR EKIVRQRAET RVGCRAMILV RKASSGKWEV TKFVKEHTHS LTPGKARRDC  180
IYDQYPNEHD KIRELSQQLA LEKKRAATYK RHLELIFEQI EEHNESLSKK IQHIVHSVRG  240
MENKPQQSQT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2146280.0AC214628.1 Populus trichocarpa clone POP040-F15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006372863.10.0hypothetical protein POPTR_0017s05780g
TrEMBLU5FI750.0U5FI75_POPTR; Uncharacterized protein
STRINGPOPTR_0017s05780.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10299610
FabidsOGEF24533072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.21e-114FAR1 family protein