PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.T120700.1
Common NamePOPTR_0004s07310g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 642aa    MW: 70604.9 Da    PI: 6.909
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.T120700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94e-192478256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     +  ++++++q+++Le++F+++++p++++r++L+++lgL+ +q+k+WFqN+R+++k
  Potri.T120700.1 24 KAYHRHSNQQIHQLEKFFKECPHPDENQRRQLSRELGLEAKQIKFWFQNKRTQKK 78
                     567889**********************************************988 PP

2START58.91.7e-19289374118206
                      .TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 118 lgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                      l+ g wvi+d+S d  ++ +      Ra +lpSg++i++ksng skvtwvehv++++r+  h l+r l+  + a ga +w a l+r ce+
  Potri.T120700.1 289 LEPGEWVIADISYDFMRDGSP----SRAWRLPSGCMIQDKSNGCSKVTWVEHVEVDDRTQtHRLYRDLICGRSAYGAERWIASLRRICER 374
                      6789**************986....89*******************************999**************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-20982IPR009057Homeodomain-like
SuperFamilySSF466892.09E-171682IPR009057Homeodomain-like
PROSITE profilePS5007116.6172080IPR001356Homeobox domain
SMARTSM003893.4E-162284IPR001356Homeobox domain
CDDcd000861.32E-162481No hitNo description
PfamPF000461.4E-162578IPR001356Homeobox domain
PROSITE patternPS0002705578IPR017970Homeobox, conserved site
PROSITE profilePS5084811.568202251IPR002913START domain
SuperFamilySSF559613.3E-12203375No hitNo description
SMARTSM002340.0048211374IPR002913START domain
PROSITE profilePS5084818.159252377IPR002913START domain
PfamPF018523.5E-15289374IPR002913START domain
SuperFamilySSF559611.92E-15395604No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MGNNGGASGD EHEAASNSRN QGNKAYHRHS NQQIHQLEKF FKECPHPDEN QRRQLSRELG  60
LEAKQIKFWF QNKRTQKKAQ SERADNSVLR LENERIQCEN LAIIEALKNV ICPACGGPPF  120
GEEERQRSLQ KLKQENARLK EEHEKVSTLL TKYIGKSISQ IDSLTPGAGS SHGVLTTNPG  180
IDLERNPGLD NSQLVYKRRG ILDMEKALMA ETAASAADEL VRLLRVNEPL WIKSPSDGRY  240
ILDRVGYEKL YPRDSHFKSS NARVESSKDS AMVIMPGMDL VDMFLDPQLE PGEWVIADIS  300
YDFMRDGSPS RAWRLPSGCM IQDKSNGCSK VTWVEHVEVD DRTQTHRLYR DLICGRSAYG  360
AERWIASLRR ICERLAFYKE ETAAAREFGG VITSPEGRKS IVNLAHRMVK IFFASLGMSG  420
KLDFPQLSEV HNSGVRVAIR KNTEQGQPIG MVVSAATSLW LPLSPQNVFN FFKDEKSRIQ  480
WDILSNSNPV HVISHISNGT NPGNCISITH PFIPTENNML ILQESCTDSS GSMVVYAPLD  540
IPAMNMVIGG ADSSIIPILP SGFVISGDGR PDTGGDSSTS TSSTGADSGG SLLTVAFQIL  600
VAGPNVTSST ELNMESVATV NTLISTTVLK IKAALNCSNL G*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.T120700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024448785.10.0homeobox-leucine zipper protein ROC8-like
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLA0A2K1R6310.0A0A2K1R631_POPTR; Uncharacterized protein
STRINGPOPTR_0004s07310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF10263398
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11