PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.T105400.1
Common NamePOPTR_0017s02220g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 180aa    MW: 19544.3 Da    PI: 5.5295
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.T105400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like728.5e-231411555
          G2-like 15 veaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     v+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Potri.T105400.1  1 VHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 41
                     89**************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.8E-19141IPR009057Homeodomain-like
SuperFamilySSF466897.35E-8142IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-16141IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
VHAVELLGGH ERATPKSVLE LMDVKDLTLA HVKSHLQMYR TVKTTDKPAA SSDGSGEEDM  60
APIASFRTAN EQGGLQRAVQ ADGSTAQQDM DYPSTTTSAA TTLWSNSSSG REAWPQTNSN  120
DIDGHRQGTF QSQQRSGHQM EECNSTQLKS YLGSSNMDCK NPSLEFTLGR PDWQGKEHC*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In globular embryos, expressed in the peripheral cells in a basal region above the hypophysis. In heart-stage embryos, expressed in the periphery of the presumptive hypocotyl and on the abaxial side of cotyledon primordia. During vegetative growth, expressed the abaxial side of very young leaf primordia. Expressed on the abaxial side of carpel primordia and then in a localized region on the abaxial margin that gives rise to the septum. Later, expressed in the tissue that gives rise to ovules. {ECO:0000269|PubMed:11525739}.
UniprotTISSUE SPECIFICITY: Expressed in developing phloem and lateral root. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269|PubMed:11395775, ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928, ECO:0000269|PubMed:18849474, ECO:0000269|PubMed:20179097}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.T105400.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269|PubMed:18849474}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142142e-86AC214214.1 Populus trichocarpa clone POP028-A01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024448674.11e-132transcription repressor KAN1
SwissprotQ93WJ96e-51KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A2K1X7N11e-125A0A2K1X7N1_POPTR; Uncharacterized protein
STRINGPOPTR_0017s02220.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-49G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Huang T,Kerstetter RA,Irish VF
    APUM23, a PUF family protein, functions in leaf development and organ polarity in Arabidopsis.
    J. Exp. Bot., 2014. 65(4): p. 1181-91
    [PMID:24449383]
  3. Mach J
    Getting in Shape? Leaves work it out with KANADI1.
    Plant Cell, 2014. 26(1): p. 4
    [PMID:24464293]
  4. Jun SE, et al.
    Comparative analysis of the conserved functions of Arabidopsis DRL1 and yeast KTI12.
    Mol. Cells, 2015. 38(3): p. 243-50
    [PMID:25518926]
  5. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  6. Xie Y, et al.
    Meta-Analysis of Arabidopsis KANADI1 Direct Target Genes Identifies a Basic Growth-Promoting Module Acting Upstream of Hormonal Signaling Pathways.
    Plant Physiol., 2015. 169(2): p. 1240-53
    [PMID:26246448]
  7. Alvarez JP,Furumizu C,Efroni I,Eshed Y,Bowman JL
    Active suppression of a leaf meristem orchestrates determinate leaf growth.
    Elife, 2017.
    [PMID:27710768]
  8. Singh A, et al.
    Phytohormonal crosstalk modulates the expression of miR166/165s, target Class III HD-ZIPs, and KANADI genes during root growth in Arabidopsis thaliana.
    Sci Rep, 2017. 7(1): p. 3408
    [PMID:28611467]
  9. Caggiano MP, et al.
    Cell type boundaries organize plant development.
    Elife, 2018.
    [PMID:28895530]
  10. Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F
    Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers.
    Development, 2018.
    [PMID:29361563]