PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.T101400.1
Common NamePOPTR_0017s06810g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 204aa    MW: 23343.5 Da    PI: 5.4096
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.T101400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.36.5e-212068149
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     k+ie+ksn qvtfskRr g+ KKA+ELS LC+a+va++ fs+  k++ +
  Potri.T101400.1 20 KQIEEKSNLQVTFSKRRGGLVKKASELSLLCGAQVAILAFSPGKKVFAF 68
                     68****************************************9999877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.3481272IPR002100Transcription factor, MADS-box
SMARTSM004324.0E-271271IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.23E-261386IPR002100Transcription factor, MADS-box
CDDcd002651.29E-331385No hitNo description
PRINTSPR004046.6E-201434IPR002100Transcription factor, MADS-box
PfamPF003196.0E-222268IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-203449IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-204970IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MMMLNKRKKQ TQGRQKIEIK QIEEKSNLQV TFSKRRGGLV KKASELSLLC GAQVAILAFS  60
PGKKVFAFGH RDVDMVLDRY LTESSTAGEL GAASNDPQVQ QWNKEYEEAL KELEEEKKHV  120
AMAEQWNKVC ENNVNARFWW DEPIDDMELE ELEEYVRAME ELKKNVAARA NELTMANDHF  180
GNQNMSHHLD LGVHGFSLEN VLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A1e-1613110187Myocyte-specific enhancer factor 2A
3kov_B1e-1613110187Myocyte-specific enhancer factor 2A
3kov_I1e-1613110187Myocyte-specific enhancer factor 2A
3kov_J1e-1613110187Myocyte-specific enhancer factor 2A
3p57_A1e-1613110187Myocyte-specific enhancer factor 2A
3p57_B1e-1613110187Myocyte-specific enhancer factor 2A
3p57_C1e-1613110187Myocyte-specific enhancer factor 2A
3p57_D1e-1613110187Myocyte-specific enhancer factor 2A
3p57_I1e-1613110187Myocyte-specific enhancer factor 2A
3p57_J1e-1613110187Myocyte-specific enhancer factor 2A
5f28_A2e-1613114292MEF2C
5f28_B2e-1613114292MEF2C
5f28_C2e-1613114292MEF2C
5f28_D2e-1613114292MEF2C
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.T101400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006372987.11e-150agamous-like MADS-box protein AGL62
RefseqXP_024448636.11e-150agamous-like MADS-box protein AGL62
TrEMBLU5FKM81e-148U5FKM8_POPTR; Uncharacterized protein
STRINGPOPTR_0017s06810.11e-142(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-35AGAMOUS-like 62