PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.T034400.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 1039aa    MW: 114374 Da    PI: 9.7892
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.T034400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.67.8e-0776132157
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      +r+R  ++++ ++ ++e+F  +  +s++e +e++++ g t +qV+ +F  +R++ +k
  Potri.T034400.2  76 KRPRDLINPKAVKYMQEVFSIKDAISKKESREISAQFGATVTQVRDFFASQRMRVRK 132
                      799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.92873133IPR001356Homeobox domain
SMARTSM003891.3E-475137IPR001356Homeobox domain
SuperFamilySSF466891.24E-676136IPR009057Homeodomain-like
CDDcd000863.83E-576132No hitNo description
Gene3DG3DSA:1.10.10.603.0E-676138IPR009057Homeodomain-like
SuperFamilySSF476768.37E-6236328IPR017923Transcription factor IIS, N-terminal
Gene3DG3DSA:1.20.930.102.1E-4236328IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1039 aa     Download sequence    Send to blast
MRSCAGTSKI ETAPVFEFDN GGFDRNRDWE LCGVVSKVFR FAERAFSQPN RSSSKNCCYS  60
MQTHRRCSAL SIKIGKRPRD LINPKAVKYM QEVFSIKDAI SKKESREISA QFGATVTQVR  120
DFFASQRMRV RKLVRLSREK AIRVNAHKGP QDGVPTTSDA LMPVDLVPLN SVAPNPVPMN  180
TVSPNPAPLN ADDVLPGLDE LDKHFAEKIF DLLRKEETFS GQVKLMEWIL QIQTPAVLNW  240
FLVKGGVMIL TTWLSQAAAE EQTSVLLVTL KVFCHLPLHK APPEHMSAVL HSVNGLRFYR  300
TPDISNRARV LLSKWSKMFA KSQAIKKPNG IKSSTDAQDM ILKQSIDEIM GNESWQSDIG  360
NPDGVLALSS ESSENIRKIE SSQALKLLPA STDDLSRKHI LGASSSHTRE RRKVQLVEQP  420
GQKTAGRSPQ ATKAAPVNQG RPMSADDIQK AKMRALFMQN KHGKTGSSSN GSTGMKNGGL  480
NKPSSMIPSL CPVSKIHIRP KIEEYKKPVT PPPQVSSKVE GFLDLKKEIN SKEPMGGVCI  540
KVQIPWQTPP EIKLSVLWRV GTGENSKEVD VQKNRNRREI ETIYQTVQQI PSNPKEPWDL  600
EMDYDDTLTP EIPIEQPPDA DVAETQVSHT EHVNTVVASA PSLPQVGGGS ATEPDLELLA  660
VLLKNPELVF ALTSGQAGNL SSEETVKLLD MIKTGGAGLA GSLNGLGGKV EEKVEVSLPS  720
PTPSSNNPGT SGWRSEFAKN PFSQQASMGN RVVYSDPGVP TSVPLAEKHT SLVQHQNQAT  780
SIRIPQHVSA VMNPFSMPQT SSIVPENRQP SIVLPANQSY PSNSSMLQTP SSEMVSTMKI  840
LPVNTPSLLN LSAAMNNIKS TPSVSFTSNP QERRLVPFPP STTAVPTPTQ LQSQPPQINE  900
PPIVYFTRPH TGDVGPVADS WRVRQGLVSN SPSQVNQTNY VSSFGGPVQP SLRSGPPRER  960
NEYVSDVGDE GYESWSPENR RYESQEYMPG RNHSGPRSRM NSGWDYMPNN NNNNNNRSRQ  1020
RNSSGHGDRN WNGNRRWH*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates prior to flowering in the vegetative shoot apical meristem and after flowering in floral meristems.
UniprotTISSUE SPECIFICITY: Expressed in shoot apex, root apex, leaf primordia and floral buds.
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.T034400.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011009535.10.0PREDICTED: homeobox protein LUMINIDEPENDENS-like
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A2K1R9330.0A0A2K1R933_POPTR; Uncharacterized protein
STRINGPOPTR_0002s20990.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-158HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]