PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.T034400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 1142aa    MW: 124925 Da    PI: 9.6138
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.T034400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.48.7e-0784140157
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      +r+R  ++++ ++ ++e+F  +  +s++e +e++++ g t +qV+ +F  +R++ +k
  Potri.T034400.1  84 KRPRDLINPKAVKYMQEVFSIKDAISKKESREISAQFGATVTQVRDFFASQRMRVRK 140
                      799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.92881141IPR001356Homeobox domain
SMARTSM003891.3E-483145IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.4E-684146IPR009057Homeodomain-like
SuperFamilySSF466891.37E-684144IPR009057Homeodomain-like
CDDcd000863.04E-584140No hitNo description
Gene3DG3DSA:1.20.930.102.3E-4339431IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476769.42E-6339431IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1142 aa     Download sequence    Send to blast
MRSCAGTSKI ETAPVFEFDN GGFDRNRDWE LCGVVSKVFR FAERAFSQPN RSSSKNCCYS  60
MQTHRRQSSF SRNGCSALSI KIGKRPRDLI NPKAVKYMQE VFSIKDAISK KESREISAQF  120
GATVTQVRDF FASQRMRVRK LVRLSREKAI RVNAHKGPQD GVPTTSDALM PVDLVPLNSV  180
APNPVPMNTV SPNPAPLNAV IPNPFYLNSV APNPVPFSFV SSSSAPLNFA SPTSSLLNSS  240
SPNPVPLISA SLNPVPLNPA SLNPVPLDSV AQDPVPLNAV GPSRVDEVPS CSTQDDVLPG  300
LDELDKHFAE KIFDLLRKEE TFSGQVKLME WILQIQTPAV LNWFLVKGGV MILTTWLSQA  360
AAEEQTSVLL VTLKVFCHLP LHKAPPEHMS AVLHSVNGLR FYRTPDISNR ARVLLSKWSK  420
MFAKSQAIKK PNGIKSSTDA QDMILKQSID EIMGNESWQS DIGNPDGVLA LSSESSENIR  480
KIESSQALKL LPASTDDLSR KHILGASSSH TRERRKVQLV EQPGQKTAGR SPQATKAAPV  540
NQGRPMSADD IQKAKMRALF MQNKHGKTGS SSNGSTGMKN GGLNKPSSMI PSLCPVSKIH  600
IRPKIEEYKK PVTPPPQVSS KVEGFLDLKK EINSKEPMGG VCIKVQIPWQ TPPEIKLSVL  660
WRVGTGENSK EVDVQKNRNR REIETIYQTV QQIPSNPKEP WDLEMDYDDT LTPEIPIEQP  720
PDADVAETQV SHTEHVNTVV ASAPSLPQVG GGSATEPDLE LLAVLLKNPE LVFALTSGQA  780
GNLSSEETVK LLDMIKTGGA GLAGSLNGLG GKVEEKVEVS LPSPTPSSNN PGTSGWRSEF  840
AKNPFSQQAS MGNRVVYSDP GVPTSVPLAE KHTSLVQHQN QATSIRIPQH VSAVMNPFSM  900
PQTSSIVPEN RQPSIVLPAN QSYPSNSSML QTPSSEMVST MKILPVNTPS LLNLSAAMNN  960
IKSTPSVSFT SNPQERRLVP FPPSTTAVPT PTQLQSQPPQ INEPPIVYFT RPHTGDVGPV  1020
ADSWRVRQGL VSNSPSQVNQ TNYVSSFGGP VQPSLRSGPP RERNEYVSDV GDEGYESWSP  1080
ENRRYESQEY MPGRNHSGPR SRMNSGWDYM PNNNNNNNNR SRQRNSSGHG DRNWNGNRRW  1140
H*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates prior to flowering in the vegetative shoot apical meristem and after flowering in floral meristems.
UniprotTISSUE SPECIFICITY: Expressed in shoot apex, root apex, leaf primordia and floral buds.
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.T034400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024447987.10.0uncharacterized protein LOC18096466
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A2K1R9330.0A0A2K1R933_POPTR; Uncharacterized protein
STRINGPOPTR_0002s20990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Representative plantOGRP41211315
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-110HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]