PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.019G085600.1
Common NamePOPTR_0019s11540g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 464aa    MW: 52729.2 Da    PI: 7.0887
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.019G085600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS312.59.4e-96824601374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lLl +A+a+++++   a + L++l + +s +gd++qR++ayf+ +Laarl+++ s  y+ +  ++t     +ee+ a++ ++ vsP++
  Potri.019G085600.1  82 LIHLLLIAATALDENNVGSALENLTELYQSVSLSGDSVQRVVAYFADGLAARLLGKKSPFYDMIMKEPT----CEEEFLAFTDLYRVSPYY 168
                         689**********************************************************98887777....5788899999******** PP

                GRAS  92 kfshltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeel.gv 174
                         +f+h+taNqaIlea e+e     + +H+iDfd+s+G+QWp+L+q+L++++  ++  slRiTg+g+    + eel+et++rL +fA+ + ++
  Potri.019G085600.1 169 QFAHFTANQAILEAYEKEeennnSSLHVIDFDVSYGFQWPSLIQSLSEKAssGNRISLRITGFGR----RIEELQETESRLLSFAKGFrNL 255
                         ****************9977777789**********************99745556*********....9****************9758* PP

                GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                          fef+ l    l   +l +Lr k++E++aVnlv++l +l  +s+++++    +Lk v sl+P +vv+veqe +++  sFl rf+e+l+y++
  Potri.019G085600.1 256 VFEFQGL----LRGSKLFNLRKKKNETVAVNLVFHLNTLN-DSLKISD----TLKSVHSLNPSIVVLVEQEGSRSPRSFLSRFMESLHYFA 337
                         ******8....7777789******************9995.8888888....*************************************** PP

                GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllr......kvksdg. 348
                         a+fdsl+  lp es+er ++E+  lg++i+ ++ c +++    r  ++e+W+ r+e  GF  ++ls+k   qaklll+        ++dg 
  Potri.019G085600.1 338 AMFDSLDDCLPLESSERLSIEKNHLGKDIKRMLNCDKDDaNCPRYDKMETWKGRMEGHGFAGIKLSSKSLIQAKLLLKirthycPLQFDGd 428
                         ************************************9996789*********************************983322211123434 PP

                GRAS 349 ....yrveee.sgslv.lgWkdrpLvsvSaWr 374
                             ++v e+ +g  + lgW+dr L+++SaWr
  Potri.019G085600.1 429 fcggFKVFERdDGKGIsLGWQDRYLITASAWR 460
                         44447776543666667**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.71956427IPR005202Transcription factor GRAS
PfamPF035143.2E-9382460IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MEGMEDQEEL LNLSLAIVTD SNGDMKRKRK RSRADVSNPL MNTYEGRSEG KIFRLLQMRE  60
QMLKLDHKRK GAVEENGKGL HLIHLLLIAA TALDENNVGS ALENLTELYQ SVSLSGDSVQ  120
RVVAYFADGL AARLLGKKSP FYDMIMKEPT CEEEFLAFTD LYRVSPYYQF AHFTANQAIL  180
EAYEKEEENN NSSLHVIDFD VSYGFQWPSL IQSLSEKASS GNRISLRITG FGRRIEELQE  240
TESRLLSFAK GFRNLVFEFQ GLLRGSKLFN LRKKKNETVA VNLVFHLNTL NDSLKISDTL  300
KSVHSLNPSI VVLVEQEGSR SPRSFLSRFM ESLHYFAAMF DSLDDCLPLE SSERLSIEKN  360
HLGKDIKRML NCDKDDANCP RYDKMETWKG RMEGHGFAGI KLSSKSLIQA KLLLKIRTHY  420
CPLQFDGDFC GGFKVFERDD GKGISLGWQD RYLITASAWR ICA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-42874608375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2134230.0AC213423.1 Populus trichocarpa clone POP042-P09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002326001.20.0hypothetical protein POPTR_0019s11540g
TrEMBLB9IQL00.0B9IQL0_POPTR; Uncharacterized protein
STRINGPOPTR_0019s11540.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP81961117
FabidsOGEF62002952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04890.14e-58SCARECROW-like 21