PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.019G081300.1
Common NamePOPTR_0019s11070g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ZF-HD
Protein Properties Length: 185aa    MW: 20870.7 Da    PI: 10.5746
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.019G081300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer82.84.1e-261481058
         ZF-HD_dimer 10 lkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                        ++NhAas+Ggha DGCgEfmp  g+egt + l+CaACgCHRnFHRr+ +
  Potri.019G081300.1  1 MRNHAASIGGHANDGCGEFMPR-GDEGTRDWLTCAACGCHRNFHRRQGS 48
                        69*******************9.999********************866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-14146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.3E-24146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152322.955146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.8E-23246IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.6E-2997164IPR009057Homeodomain-like
SuperFamilySSF466895.14E-1998164IPR009057Homeodomain-like
TIGRFAMsTIGR015654.1E-27104160IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MRNHAASIGG HANDGCGEFM PRGDEGTRDW LTCAACGCHR NFHRRQGSTK RQHQQQLLLS  60
PPPQTQQFLL YGAPTDINMN RPVHDFVSRE GKGFMVKNAG SNNKRLRTKF TQEQKERMLE  120
FAEKIGWRIQ KHDDMALNQF CNEVGVKRNV LKVWMHNNKN AHRRRDGAPP VSAEAPPPPP  180
PVGV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-271021611675ZF-HD homeobox family protein
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.66371e-94bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in flowers and, to a lower extent, in inflorescence, stems and leaves. {ECO:0000269|PubMed:16428600}.
Functional Description ? help Back to Top
Source Description
UniProtEssential protein. Putative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.019G081300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024446661.11e-119zinc-finger homeodomain protein 2
SwissprotQ9SB615e-53ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA0A3N7HD751e-118A0A3N7HD75_POPTR; Uncharacterized protein
STRINGPOPTR_0019s11070.11e-138(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF150921014
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.11e-50homeobox protein 22
Publications ? help Back to Top
  1. Bueso E,Serrano R,Pallás V,Sánchez-Navarro JA
    Seed tolerance to deterioration in arabidopsis is affected by virus infection.
    Plant Physiol. Biochem., 2017. 116: p. 1-8
    [PMID:28477474]