PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.019G068800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 595aa    MW: 66730.8 Da    PI: 4.7305
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.019G068800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS279.69e-862155913373
                GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn....sseelaal....... 81 
                         e Ll+ Ae vs +++  a++lL++ +e +s  g+p++R++ yf eAL++r+   s+  +++ l+ +++ +      +              
  Potri.019G068800.1 215 EFLLASAEKVSCEQFDSARRLLKHCEECSSDVGNPVERVVYYFSEALRERIEIkSGRVTSNGLKKNQSVHIYdtmkT------Skqsfdkd 299
                         6799***********************************************97344444444444443321122211......12233455 PP

                GRAS  82 ........kl..fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetg 162
                                 ++   + v P+ ++sh++  qaI+e v++++r+HiiD+ i +G+QW+ L+qaL         l+iT++g    +sk+ +e tg
  Potri.019G068800.1 300 tammrpnpTIleCQRVMPFCQISHFAGIQAIVENVAEAKRIHIIDLVIRNGAQWAILMQALCP----LELLKITAIGT---TSKHLIEDTG 383
                         55555555225689***********************************************85....689********...6899****** PP

                GRAS 163 erLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                         + L++fA+++++pf+f+++++++l dl+ + L+++ +E++aV +++   +l     +++++ d+++k++++++P ++vv+e ea+hn++sF
  Potri.019G068800.1 384 RWLKSFAQNMNIPFSFKIVMVSDLLDLKENLLEIDVEEKIAVYSSYLPRKLI----AMPNRLDSMMKMIRNINPCIMVVTEVEANHNAPSF 470
                         **********************************************777776....88888888*************************** PP

                GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                         ++rf++ l yysa fd+l+a + r++ +r+  E  ++g+ i+n va eg+er+ r  +l  Wr+ + ++G+ +  ls++  +qakl+++k+
  Potri.019G068800.1 471 VHRFVDLLFYYSAYFDCLDACMERDDPNRMITESLYFGEGIRNSVASEGEERIIRSVKLDVWRAFFARFGMVETDLSSSSLDQAKLIVKKF 561
                         ******************************************************************************************* PP

                GRAS 345 k.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                         +    ++++ + +sl++gWk+ pL s+SaW
  Potri.019G068800.1 562 NfASSFTLDVDGKSLLFGWKGTPLHSLSAW 591
                         *9899************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.376187571IPR005202Transcription factor GRAS
PfamPF035143.1E-83215591IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MENAILSLEG NNPEVEEKSS SANKSSESVD GGKTWKQTPF YCSEGLGLSA GVDSLCSEDE  60
VLYQDEQELQ DQTLLGYATF DDLKFDGLSP SIQNCQEEIT KLGAIVQNGN QDSEHKKDKR  120
SEELHLGSLE LLRRFGNGFR FLTSGRIVEP TYDAPPYTAV ESQGFSTEEI MGIAGAKFIQ  180
SASQSVDVSS MFDSPFDLSL AGLSHEDAKM VELSEFLLAS AEKVSCEQFD SARRLLKHCE  240
ECSSDVGNPV ERVVYYFSEA LRERIEIKSG RVTSNGLKKN QSVHIYDTMK TSKQSFDKDT  300
AMMRPNPTIL ECQRVMPFCQ ISHFAGIQAI VENVAEAKRI HIIDLVIRNG AQWAILMQAL  360
CPLELLKITA IGTTSKHLIE DTGRWLKSFA QNMNIPFSFK IVMVSDLLDL KENLLEIDVE  420
EKIAVYSSYL PRKLIAMPNR LDSMMKMIRN INPCIMVVTE VEANHNAPSF VHRFVDLLFY  480
YSAYFDCLDA CMERDDPNRM ITESLYFGEG IRNSVASEGE ERIIRSVKLD VWRAFFARFG  540
MVETDLSSSS LDQAKLIVKK FNFASSFTLD VDGKSLLFGW KGTPLHSLSA WNFT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3323659226375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011004895.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A067JYC80.0A0A067JYC8_JATCU; GRAS41 protein
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP2520734
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-52RGA-like 1